Property Summary

NCBI Gene PubMed Count 364
Grant Count 745
R01 Count 510
Funding $50,600,232.6
PubMed Score 1084.96
PubTator Score 517.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.563 0.015
Multiple myeloma 1.192 0.030
psoriasis 1.100 0.013
group 3 medulloblastoma 1.400 0.000
primitive neuroectodermal tumor 1.400 0.000
Amyotrophic Lateral Sclerosis 1.118 0.000
lung cancer 1.500 0.028
Breast cancer 2.400 0.028
subependymal giant cell astrocytoma 1.073 0.035
ovarian cancer 2.100 0.000
pituitary cancer 1.200 0.000
dermatomyositis 1.300 0.001

Synonym

Accession Q15796 MAD homolog 2
Symbols JV18
MADH2
MADR2
JV18-1
hMAD-2
hSMAD2

Gene

PANTHER Protein Class (1)

PDB

2LB3   1U7V   1DEV   1KHX  

Gene RIF (223)

PMID Text
26974954 data suggest that TGF-beta1 enhances IGFBP7 via Smad2/4 pathways, and that IGFBP7 might be involved in the TGF-beta1-induced tubular injury in DN.
26802603 Smad2 enhances TRAIL-induced apoptosis in activated hepatic stellate cells, which facilitates the resolution of hepatic fibrosis
26708185 correlation between TGFb1 and pSmad2 as well as between HtrA1 and TGFb1 and the very significant increase of Ki67 in stromal compartment of eutopic endometrium suggest a possible involvement of HtrA1 in the pathogenesis of endometriosis.
26680585 Data suggest SHC1 (SH2 domain protein C1) expression down-regulates epithelial-mesenchymal transition by repressing TGFB-induced SMAD2/3 activation through differential partitioning of receptors at cell surface of mammocytes/keratinocytes.
26674378 MiR-425 functions as an oncogene by targeting the 3'-UTR of SMAD2 in esophageal squamous cell carcinoma.
26647993 The present study thus proposed SEB as an agent able to significantly reduce Smad2/3 expression in colon cancer cells, provoking moderate TGFb growth signaling and the reduction of tumor cell proliferation.
26608417 Suggest that greater tumor associated macrophage density, strong Hexim1 expression, strong SMAD2 expression, and mild SMAD7 expression play important roles in the progression of prostate adenocarcinoma.
26445225 TGF-beta/Smad signalling pathway and VEGF-A participate in the pathogenesis of sarcoidosis.
26384307 Up-regulation of smad2 is associated with endometrial cancer.
26383977 Relationship between Expression of TGF-beta1, Smad2, Smad4 and Prognosis of Patients with Resected Non-small Cell Lung Cancer
More...

AA Sequence

MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNC      1 - 70
NTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSH     71 - 140
HELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI    141 - 210
EPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY    211 - 280
ELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECL    281 - 350
SDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK    351 - 420
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS                           421 - 467
//

Text Mined References (384)

PMID Year Title
26974954 2016 Role of IGFBP7 in Diabetic Nephropathy: TGF-?1 Induces IGFBP7 via Smad2/4 in Human Renal Proximal Tubular Epithelial Cells.
26802603 2016 Smad2 increases the apoptosis of activated human hepatic stellate cells induced by TRAIL.
26708185 2015 High temperature requirement A1, transforming growth factor beta1, phosphoSmad2 and Ki67 in eutopic and ectopic endometrium of women with endometriosis.
26680585 2015 ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-?-Induced Smad Activation.
26674378 2015 Enhanced Expression of miR-425 Promotes Esophageal Squamous Cell Carcinoma Tumorigenesis by Targeting SMAD2.
26647993 2016 Modulation of transforming growth factor?? signaling transducers in colon adenocarcinoma cells induced by staphylococcal enterotoxin B.
26608417 2016 Role of tumor-associated macrophages in the Hexim1 and TGF?/SMAD pathway, and their influence on progression of prostatic adenocarcinoma.
26445225 2015 Immunoexpression of TGF-?/Smad and VEGF-A proteins in serum and BAL fluid of sarcoidosis patients.
26384307 2015 Activin B induces human endometrial cancer cell adhesion, migration and invasion by up-regulating integrin ?3 via SMAD2/3 signaling.
26383977 2015 [Relationship between Expression of TGF-?1, Smad2, Smad4 and Prognosis ?of Patients with Resected Non-small Cell Lung Cancer].
More...