Property Summary

NCBI Gene PubMed Count 411
PubMed Score 1515.74
PubTator Score 517.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.118 9.8e-06
Breast cancer 2.400 2.8e-02
dermatomyositis 1.300 1.4e-03
group 3 medulloblastoma 1.400 1.4e-04
lung cancer 1.500 2.8e-02
Multiple myeloma 1.192 3.0e-02
ovarian cancer -1.600 3.1e-04
pituitary cancer 1.200 1.6e-05
primitive neuroectodermal tumor 1.400 9.9e-05
psoriasis 1.100 1.3e-02
subependymal giant cell astrocytoma 1.073 3.5e-02
Waldenstrons macroglobulinemia 1.563 1.5e-02

Gene RIF (265)

AA Sequence

MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNC      1 - 70
NTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSH     71 - 140
HELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI    141 - 210
EPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY    211 - 280
ELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECL    281 - 350
SDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK    351 - 420
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS                           421 - 467
//

Text Mined References (431)

PMID Year Title