Property Summary

NCBI Gene PubMed Count 168
PubMed Score 231.03
PubTator Score 172.60

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count P-value
Breast cancer 3099 3.44062945328545E-9
ovarian cancer 8492 3.46599288152331E-8
atypical teratoid / rhabdoid tumor 4369 9.39731513024601E-7
acute quadriplegic myopathy 1157 7.02982638904625E-6
medulloblastoma, large-cell 6234 1.43751070030168E-5
adult high grade glioma 2148 3.42949439304832E-5
invasive ductal carcinoma 2950 1.00817921207349E-4
psoriasis 6685 3.30239791145724E-4
osteosarcoma 7933 4.27673809884404E-4
glioblastoma 5572 0.00140349730727188
aldosterone-producing adenoma 664 0.0165335935863038
astrocytoma 1493 0.0346752003796208
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 104 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.586 1.8


  Differential Expression (12)

Disease log2 FC p
psoriasis -1.500 0.000
osteosarcoma -1.922 0.000
astrocytoma 1.200 0.035
atypical teratoid / rhabdoid tumor -1.900 0.000
glioblastoma -1.200 0.001
medulloblastoma, large-cell -2.100 0.000
acute quadriplegic myopathy 1.364 0.000
adult high grade glioma -1.200 0.000
aldosterone-producing adenoma -1.026 0.017
invasive ductal carcinoma -1.049 0.000
Breast cancer -1.100 0.000
ovarian cancer -2.100 0.000


Accession Q15788 O00150 O43792 O43793 Q13071 Q13420 Q2T9G5 Q53SX3 Q6GVI5 Q7KYV3 NCoA-1
Symbols SRC1



3BEJ   3DCT   3DCU   3FXV   3HC5   3HC6   3OKH   3OKI   3OLF   3OMK   3OMM   3OOF   3OOK   3P88   3P89   3RUT   3RUU   3RVF   3UU7   3UUA   3UUD   4MG5   4MG6   4MG7   4MG8   4MG9   4MGA   4MGB   4MGC   4MGD   4TUZ   4TV1   1XV9   1XVP   1PZL   1KV6   1TFC   1FM6   1FM9   1K74   1RDT   2FVJ   2GTK   2HFP   2PRG   3CWD   3ET3   3FEJ   3FUR   3G9E   3H0A   3LMP   3QT0   3S9S   3T03   3V9Y   3VN2   4F9M   4FGY   4HEE   4Y29   5DV6   5DWL   1K7L   2NPA   2P54   3ET1   3FEI   3G8I   5AZT   1NRL   3CTB   3HVL   4J5X   5A86   3KMR   4DQM   4DM6   4DM8   4JYG   4JYH   4JYI   1U3R   1U3S   1X76   1X78   1X7B   1X7J   1YY4   1YYE   1ZAF   2NV7   3OLL   3OLS   3OMO   3OMP   3OMQ   2A3I   4UDA   4UDB   1P8D   4DK7   4DK8   3BQD   1K4W   1N4H   1NQ7   1XIU   2C52   2HBH   2HC4   2HCD   3DR1   3GYT   3GYU   3IPQ   3IPS   3IPU   4G1D   4G1Y   4G1Z   4G20   4G21   4G2H   4RUJ   4RUP   5AVI   5AVL   5DVC   5E7V   5HJS  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

MLP Assay (13)

AID Type Active / Inconclusive / Inactive Description
631 screening 811 / 0 / 195445 Primary biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 1 (SRC-1) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1051 other 335 / 0 / 99032 Measurement of TR-FRET detection format artefact in the screen for agonists of steroid receptor coactivator 1 (SRC-1) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1300 screening 340 / 0 / 454 Confirmation biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 1 (SRC-1) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1319 confirmatory 10 / 0 / 339 Dose response biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 1 (SRC-1) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1679 confirmatory 75 / 0 / 325 TR-FRET dose response biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 1 (SRC-1) recruitment by the peroxisome proliferator-activated receptor gamma (PPAR gamma): non-selective agonists
1808 summary 0 / 0 / 0 Summary of probe development efforts to identify agonists of the steroid receptor coactivator 1 (SRC-1) recruitment by the peroxisome proliferator-activated receptor gamma (PPAR gamma)
588354 screening 428 / 0 / 359055 Luminescence-based cell-based primary high throughput screening assay to identify inhibitors of the Steroid Receptor Coactivator 1 (SRC1; NCOA1)
588362 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of the Steroid Receptor Coactivator 1 (SRC1; NCOA1)
588820 screening 486 / 0 / 1837 Luminescence-based cell-based high throughput confirmation assay for inhibitors of the Steroid Receptor Coactivator 1 (SRC1; NCOA1).
602168 confirmatory 45 / 0 / 184 Counterscreen for inhibitors of the Steroid Receptor Coactivator 3 (SRC3; NCOA3): Luminescence-based cell-based high throughput dose response assay to identify inhibitors of the Steroid Receptor Coactivator 1 (SRC1; NCOA1)

Gene RIF (73)

26469385 HIV-1 MA upregulates NCOA1 gene expression in HepG2 cells
26371783 Report novel PAX3-NCOA1 gene fusions in biphenotypic sinonasal sarcomas with focal rhabdomyoblastic differentiation.
26287601 NCOA1 potentiates breast cancer angiogenesis through upregulating HIF1alpha and AP-1-mediated VEGFa expression
26267537 Data suggest that over-stimulating the steroid seceptor coactivators SRC-1, SRC-2, and SRC-3 oncogenic program can be an effective strategy to kill cancer cells.
26203193 Data indicate that finerenone inhibits mineralocorticoid receptor (MR), steroid receptor coactivator-1 binding at the regulatory sequence.
26066330 miR-137 has a role in targeting p160 steroid receptor coactivators SRC1, SRC2, and SRC3 and inhibits cell proliferation
25053412 Data show that disrupting the steroid receptor coactivator-1 (SRC1) binding site on retinoid X receptor alpha (RXRalpha) alters the transactivation by CAR:RXR.
24875297 Our study clearly demonstrated differentiation-dependant expression of SRC-1 and SRC-3 in chondrosarcoma
24769444 In a cohort of 453 human breast tumors, NCOA1 and CSF1 levels correlated positively with disease recurrence, higher tumor grade, and poor prognosis.
24719557 SRC1 and Twist1 expression are associated with poor survival in breast cancer.

AA Sequence

NLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE                                1401 - 1441

Text Mined References (177)

PMID Year Title
26371783 2016 Novel PAX3-NCOA1 Fusions in Biphenotypic Sinonasal Sarcoma With Focal Rhabdomyoblastic Differentiation.
26287601 2015 NCOA1 promotes angiogenesis in breast tumors by simultaneously enhancing both HIF1?- and AP-1-mediated VEGFa transcription.
26267537 2015 Characterization of a Steroid Receptor Coactivator Small Molecule Stimulator that Overstimulates Cancer Cells and Leads to Cell Stress and Death.
26203193 2015 Finerenone Impedes Aldosterone-dependent Nuclear Import of the Mineralocorticoid Receptor and Prevents Genomic Recruitment of Steroid Receptor Coactivator-1.
26066330 2015 miR-137 Targets p160 Steroid Receptor Coactivators SRC1, SRC2, and SRC3 and Inhibits Cell Proliferation.
25962847 2015 Tumor suppressor Menin acts as a corepressor of LXR? to inhibit hepatic lipogenesis.
25261932 2014 Genome-wide association study identifies multiple susceptibility loci for diffuse large B cell lymphoma.
25219498 2014 Modification of ASC1 by UFM1 is crucial for ER? transactivation and breast cancer development.
25053412 2014 Agonist ligands mediate the transcriptional response of nuclear receptor heterodimers through distinct stoichiometric assemblies with coactivators.
24875297 2014 Immunohistochemical localization of steroid receptor coactivators in chondrosarcoma: an in vivo tissue microarray study.