Property Summary

Ligand Count 1
NCBI Gene PubMed Count 183
PubMed Score 239.21
PubTator Score 172.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.074 1.2e-05
adult high grade glioma -1.200 3.4e-05
aldosterone-producing adenoma -1.026 1.7e-02
astrocytoma 1.200 3.5e-02
atypical teratoid / rhabdoid tumor -1.900 9.4e-07
Breast cancer -1.100 3.4e-09
glioblastoma -1.200 1.4e-03
invasive ductal carcinoma -1.049 1.0e-04
medulloblastoma, large-cell -2.100 1.4e-05
osteosarcoma -1.479 4.6e-04
ovarian cancer -2.100 3.5e-08
psoriasis -1.500 3.3e-04

Synonym

Accession Q15788 O00150 O43792 O43793 Q13071 Q13420 Q2T9G5 Q53SX3 Q6GVI5 Q7KYV3 NCoA-1
Symbols SRC1
KAT13A
RIP160
F-SRC-1
bHLHe42
bHLHe74

Gene

PDB

3BEJ   3DCT   3DCU   3FXV   3HC5   3HC6   3OKH   3OKI   3OLF   3OMK   3OMM   3OOF   3OOK   3P88   3P89   3RUT   3RUU   3RVF   5Q0J   5Q0K   5Q0L   5Q0M   5Q0N   5Q0O   5Q0P   5Q0Q   5Q0R   5Q0S   5Q0T   5Q0U   5Q0V   5Q0W   5Q0X   5Q0Y   5Q0Z   5Q10   5Q11   5Q12   5Q13   5Q14   5Q15   5Q16   5Q18   5Q19   5Q1A   5Q1B   5Q1C   5Q1D   5Q1E   5Q1F   5Q1G   5Q1H   5Q1I   3UU7   3UUA   3UUD   4MG5   4MG6   4MG7   4MG8   4MG9   4MGA   4MGB   4MGC   4MGD   4TUZ   4TV1   5JMM   1XV9   1XVP   1PZL   1KV6   1TFC   1FM6   1FM9   1K74   1RDT   2FVJ   2GTK   2HFP   2PRG   3CWD   3ET3   3FEJ   3FUR   3G9E   3H0A   3LMP   3QT0   3S9S   3T03   3V9Y   3VN2   4F9M   4FGY   4HEE   4Y29   5DSH   5DV3   5DV6   5DV8   5DVC   5DWL   5GTN   5GTO   5GTP   5JI0   1K7L   2NPA   2P54   3ET1   3FEI   3G8I   5AZT   1NRL   3CTB   3HVL   4J5X   5A86   5X0R   3KMR   4DQM   4DM6   4DM8   4JYG   4JYH   4JYI   1U3R   1U3S   1X76   1X78   1X7B   1X7J   1YY4   1YYE   1ZAF   2NV7   3OLL   3OLS   3OMO   3OMP   3OMQ   2A3I   4UDA   4UDB   5L7E   5L7G   5L7H   1P8D   4DK7   4DK8   3BQD   1K4W   1N4H   1NQ7   1XIU   2C52   2HBH   2HC4   2HCD   3DR1   3GYT   3GYU   3IPQ   3IPS   3IPU   4G1D   4G1Y   4G1Z   4G20   4G21   4G2H   4RUJ   4RUP   5AVI   5AVL   5E7V   5HJS   5NKY   5NMA   5NMB   5X8U   5X8W  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (82)

AA Sequence

MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSLSVKPDKCKIL      1 - 70
KKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEALDGFFFVVNCEGRIVFVSENV     71 - 140
TSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGVPWPQEATRRNSHTFNCRMLIHPPDEPGTE    141 - 210
NQEACQRYEVMQCFTVSQPKSIQEDGEDFQSCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSL    211 - 280
RAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQ    281 - 350
SPDMQPFIMGIHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR    351 - 420
QQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTGISLAQFMSPR    421 - 490
RQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSACNNNNRSYSNIPVTSLQGMNEGPNNSVGFSASSPV    491 - 560
LRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDNSSSDGKPLDSGLLHNNDRLSDGDSKYSQTS    561 - 630
HKLVQLLTTTAEQQLRHADIDTSCKDVLSCTGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPS    631 - 700
DITTLSVEPDKKDSASTSVSVTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDD    701 - 770
VKVKVEKKEQMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAV    771 - 840
TSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCIS    841 - 910
SQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLVQGGGLDVLSERFPPQQATP    911 - 980
PLIMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGTMPVQVTPPRGAFSPGMGMQPRQTLNRPPAA    981 - 1050
PNQLRLQLQQRLQGQQQLIHQNRQAILNQFAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQ   1051 - 1120
HRQRQLIQQQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQL   1121 - 1190
AANPEASLANRNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPI   1191 - 1260
PPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVSMAGGNTNVQN   1261 - 1330
MNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTEADGTQQVQQVQVFADVQCTV   1331 - 1400
NLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE                                1401 - 1441
//

Text Mined References (194)

PMID Year Title