Property Summary

Ligand Count 2
NCBI Gene PubMed Count 183
PubMed Score 239.21
PubTator Score 172.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.074 1.2e-05
adult high grade glioma -1.200 3.4e-05
aldosterone-producing adenoma -1.026 1.7e-02
astrocytoma 1.200 3.5e-02
atypical teratoid / rhabdoid tumor -1.900 9.4e-07
Breast cancer -1.100 3.4e-09
glioblastoma -1.200 1.4e-03
invasive ductal carcinoma -1.049 1.0e-04
medulloblastoma, large-cell -2.100 1.4e-05
osteosarcoma -1.479 4.6e-04
ovarian cancer -2.100 3.5e-08
psoriasis -1.500 3.3e-04

PDB (183)

Gene RIF (82)

AA Sequence

MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSLSVKPDKCKIL      1 - 70
KKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEALDGFFFVVNCEGRIVFVSENV     71 - 140
TSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGVPWPQEATRRNSHTFNCRMLIHPPDEPGTE    141 - 210
NQEACQRYEVMQCFTVSQPKSIQEDGEDFQSCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSL    211 - 280
RAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQ    281 - 350
SPDMQPFIMGIHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR    351 - 420
QQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTGISLAQFMSPR    421 - 490
RQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSACNNNNRSYSNIPVTSLQGMNEGPNNSVGFSASSPV    491 - 560
LRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDNSSSDGKPLDSGLLHNNDRLSDGDSKYSQTS    561 - 630
HKLVQLLTTTAEQQLRHADIDTSCKDVLSCTGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPS    631 - 700
DITTLSVEPDKKDSASTSVSVTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDD    701 - 770
VKVKVEKKEQMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAV    771 - 840
TSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCIS    841 - 910
SQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLVQGGGLDVLSERFPPQQATP    911 - 980
PLIMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGTMPVQVTPPRGAFSPGMGMQPRQTLNRPPAA    981 - 1050
PNQLRLQLQQRLQGQQQLIHQNRQAILNQFAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQ   1051 - 1120
HRQRQLIQQQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQL   1121 - 1190
AANPEASLANRNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPI   1191 - 1260
PPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVSMAGGNTNVQN   1261 - 1330
MNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTEADGTQQVQQVQVFADVQCTV   1331 - 1400
NLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE                                1401 - 1441
//

Text Mined References (194)

PMID Year Title