Property Summary

NCBI Gene PubMed Count 21
PubMed Score 12.81
PubTator Score 14.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
interstitial cystitis 2312 5.0e-05
lung cancer 4740 2.9e-04
colon cancer 1478 4.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Colorectal cancer 25 3.432 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer 1.100 4.4e-03
interstitial cystitis -1.300 5.0e-05
lung cancer 1.400 2.9e-04

 GO Function (1)

Gene RIF (9)

AA Sequence

MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDC      1 - 70
IKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEW     71 - 140
RLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHK    141 - 210
KAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSS    211 - 280
FADISNLLQIEPRNGPAQKLRQEVKQNLH                                             281 - 309
//

Text Mined References (29)

PMID Year Title