Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.79
PubTator Score 14.95

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer 1.100 0.004
lung cancer 1.400 0.000
interstitial cystitis -1.300 0.000

Synonym

Accession Q15785 Q53GH9 Q6IBN7 Q9NTZ3 hTom34
Symbols TOM34
URCC3
HTOM34P

Gene

PANTHER Protein Class (1)

 GO Function (1)

Gene RIF (8)

PMID Text
24567332 These results suggest that Tomm34 represents a novel scaffolding co-chaperone of Hsp70 and Hsp90, which may facilitate Hsp70/Hsp90 cooperation during protein folding
23053644 TOMM34 expression in early invasive breast cancer: a biomarker associated with poor outcome.
22178133 Results identify Tom34 as a cochaperone of Hsp70/Hsp90 in mitochondrial protein import.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18364745 Data show that NRF-1 is the main transcription factor regulating the expression of TOMM34, and that Sp1 interacts with NRF-1 to stimulate the promoter's full activity.
16820880 TOMM34 is involved in the growth of colon cancer cells
11913976 Yeast two-hybrid screening identifies binding partners of human Tom34 that have ATPase activity and form a complex with Tom34 in the cytosol
11913975 Tom34 unlike Tom20 does not interact with the leader sequences of mitochondrial precursor proteins

AA Sequence

MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDC      1 - 70
IKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEW     71 - 140
RLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHK    141 - 210
KAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSS    211 - 280
FADISNLLQIEPRNGPAQKLRQEVKQNLH                                             281 - 309
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24567332 2014 The assembly and intermolecular properties of the Hsp70-Tomm34-Hsp90 molecular chaperone complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23053644 2012 TOMM34 expression in early invasive breast cancer: a biomarker associated with poor outcome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22178133 2012 Tom34: a cytosolic cochaperone of the Hsp90/Hsp70 protein complex involved in mitochondrial protein import.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...