Property Summary

NCBI Gene PubMed Count 18
PubMed Score 43.44
PubTator Score 21.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.600 2.2e-03
astrocytic glioma -1.200 9.4e-03
Astrocytoma, Pilocytic -2.000 8.4e-07
atypical teratoid / rhabdoid tumor -1.900 4.4e-07
ependymoma -1.600 2.4e-03
glioblastoma -1.800 2.3e-09
group 4 medulloblastoma 2.500 3.1e-05
oligodendroglioma -1.300 3.3e-03
primitive neuroectodermal tumor -1.500 4.8e-03
psoriasis -2.900 4.8e-57
subependymal giant cell astrocytoma -1.846 1.7e-02

 GO Component (1)

Gene RIF (9)

AA Sequence

MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKGDAPPPPPPAPGPGAPGPARAAKPVPLRGEEGTEATL      1 - 70
AEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRKMTKARLERSKLRRQKANARERNRMHDLNAA     71 - 140
LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYVQTLCKGLSQPTTNLVAGCLQL    141 - 210
NSRNFLTEQGADGAGRFHGSGGPFAMHPYPYPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAA    211 - 280
AGGGGASPDYNSSEYEGPLSPPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVR    281 - 350
GGVHSENLLSYDMHLHHDRGPMYEELNAFFHN                                          351 - 382
//

Text Mined References (18)

PMID Year Title