Property Summary

NCBI Gene PubMed Count 15
PubMed Score 29.78
PubTator Score 18.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
psoriasis 4.100 0.000
cutaneous lupus erythematosus 2.100 0.025
glioblastoma 3.100 0.012
osteosarcoma -1.819 0.004
posterior fossa group A ependymoma 4.300 0.000
tuberculosis 1.200 0.000
non-small cell lung cancer -2.844 0.000
lung cancer -4.300 0.000
interstitial cystitis 2.500 0.000
lung adenocarcinoma -1.300 0.000
adult high grade glioma 2.800 0.001
pilocytic astrocytoma 3.100 0.000
lung carcinoma -2.200 0.000
Breast cancer -1.100 0.028
ulcerative colitis 1.700 0.011
head and neck cancer 1.200 0.042
head and neck cancer and chronic obstruc... 2.100 0.000

Gene RIF (9)

PMID Text
26733160 This review comprehensively analyzes recent data about expression pattern, and involvement of human YKL-40, YKL-39 and SI-CLP in cancer. [review]
25698171 cerebrospinal fluid CHI3L1 and CHI3L2 and serum CHI3L1 might help to define multiple sclerosis disease stage
25477513 Structural analysis demonstrates that YKL-39 interacts with chitooligosaccharides through hydrogen bonds and hydrophobic interactions. Thermodynamic analysis indicates that binding of chitooligosaccharide to YKL-39 is mainly driven by enthalpy.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of chitinase 3-like 2 (CHI3L2) in primary human brain microvascular endothelial cells
23291184 These data suggest that hYKL-39 is a novel growth and differentiation factor involved in cartilage homeostasis.
22742450 YKL-39 possesses a chitinase-like fold, but lacks key active-site residues required for catalysis.
22211103 ERK1/2 phosphorylation by CHI3L2 inhibits cell mitogenesis and proliferation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12435396 human chitinase 3-like 2 gene (YKL-39) but not chitinase 3-like 1 gene (YKL-40) is upregulated in osteoarthritic cartilage

AA Sequence

MGATTMDQKSLWAGVVVLLLLQGGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNK      1 - 70
VIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGL     71 - 140
DVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLLTAGVSAGRQMIDNSYQVEKLAKDLDFINLL    141 - 210
SFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAET    211 - 280
TVGAPASGPGAAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLK    281 - 350
NLNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSLGSL                                  351 - 390
//

Text Mined References (18)

PMID Year Title
26733160 2016 Role of chitinase-like proteins in cancer.
25698171 2015 Chitinase 3-like proteins as diagnostic and prognostic biomarkers of multiple sclerosis.
25477513 2015 Structural and thermodynamic insights into chitooligosaccharide binding to human cartilage chitinase 3-like protein 2 (CHI3L2 or YKL-39).
23558346 2013 New paralogues and revised time line in the expansion of the vertebrate GH18 family.
23291184 2013 Human YKL39 (chitinase 3-like protein 2), an osteoarthritis-associated gene, enhances proliferation and type II collagen expression in ATDC5 cells.
22742450 2012 Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide-binding properties.
22211103 2012 Two closely related human members of chitinase-like family, CHI3L1 and CHI3L2, activate ERK1/2 in 293 and U373 cells but have the different influence on cell proliferation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...