Property Summary

NCBI Gene PubMed Count 16
PubMed Score 30.77
PubTator Score 18.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 2.800 7.2e-04
Astrocytoma, Pilocytic 3.100 1.0e-06
Breast cancer -1.100 2.8e-02
cutaneous lupus erythematosus 2.100 2.5e-02
ependymoma 2.800 8.5e-05
glioblastoma 1.700 1.0e-02
head and neck cancer 1.200 4.2e-02
head and neck cancer and chronic obstruc... 2.100 3.4e-04
interstitial cystitis 2.400 3.8e-04
lung adenocarcinoma -1.100 1.5e-04
lung cancer -4.300 2.2e-06
lung carcinoma -2.200 1.5e-10
malignant mesothelioma -2.100 4.5e-06
non-small cell lung cancer -2.844 1.8e-23
osteosarcoma -1.819 3.8e-03
psoriasis 3.200 1.6e-09
tuberculosis 1.200 1.1e-04
ulcerative colitis 1.700 1.1e-02

Gene RIF (10)

AA Sequence

MGATTMDQKSLWAGVVVLLLLQGGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNK      1 - 70
VIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGL     71 - 140
DVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLLTAGVSAGRQMIDNSYQVEKLAKDLDFINLL    141 - 210
SFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAET    211 - 280
TVGAPASGPGAAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLK    281 - 350
NLNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSLGSL                                  351 - 390
//

Text Mined References (19)

PMID Year Title