Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.13
PubTator Score 10.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -3.400 1.5e-04
Breast cancer -4.100 2.2e-17
breast carcinoma -1.300 1.3e-19
colon cancer -1.900 6.2e-03
ductal carcinoma in situ -1.900 6.5e-04
group 3 medulloblastoma 1.200 7.0e-03
head and neck cancer -1.700 1.0e-02
interstitial cystitis -2.300 7.4e-03
intraductal papillary-mucinous adenoma (... -1.200 1.4e-03
intraductal papillary-mucinous carcinoma... -1.400 4.3e-04
invasive ductal carcinoma -2.200 6.6e-04
lung carcinoma 2.700 2.1e-14
malignant mesothelioma 3.300 2.3e-07
ovarian cancer 2.100 2.8e-03
posterior fossa group A ependymoma -1.700 2.1e-04
primitive neuroectodermal tumor 2.200 6.4e-03
psoriasis -1.500 6.0e-03

Synonym

Accession Q15777 D3DQZ5 E9PB10 Q59GE6
Symbols 239FB
C11orf8

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRT      1 - 70
DGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPS     71 - 140
VSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDIL    141 - 210
MTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPT    211 - 280
NPPIIFDLPNPQGS                                                            281 - 294
//

Text Mined References (19)

PMID Year Title