Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.13
PubTator Score 10.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 1.32683485604989E-19
Breast cancer 3099 2.24424564057043E-17
lung carcinoma 2844 2.13734826036506E-14
malignant mesothelioma 3163 2.31233971457177E-7
interstitial cystitis 2299 1.09171678242831E-5
atypical teratoid / rhabdoid tumor 4369 1.47461597266919E-4
posterior fossa group A ependymoma 1511 2.11383892919124E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.27321630171408E-4
ductal carcinoma in situ 1745 6.45311961366851E-4
invasive ductal carcinoma 2950 6.57443232013714E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00138461961262687
ovarian cancer 8492 0.00280467298458982
psoriasis 6685 0.00601829071249648
colon cancer 1475 0.00617053787074549
primitive neuroectodermal tumor 3031 0.00640542744809467
group 3 medulloblastoma 2254 0.00699335220318715
head and neck cancer 270 0.0101179074716968

Expression

Synonym

Accession Q15777 D3DQZ5 E9PB10 Q59GE6
Symbols 239FB
C11orf8

Gene

PANTHER Protein Class (1)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (4)

PMID Text
22262177 The overexpression of Mpped2 improves survival rate, substantially impairs tumor growth and induces neuronal differentiation.
21824479 The structures of MPPED2 and two mutants show that the poor activity of MPPED2 is not only a consequence of the substitution of an active-site histidine residue by glycine but also due to binding of AMP or GMP to the active site.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRT      1 - 70
DGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPS     71 - 140
VSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDIL    141 - 210
MTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPT    211 - 280
NPPIIFDLPNPQGS                                                            281 - 294
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
22479191 2012 Genome-wide association and functional follow-up reveals new loci for kidney function.
22262177 2012 The metallophosphodiesterase Mpped2 impairs tumorigenesis in neuroblastoma.
21940522 2011 Genome-wide association scan for childhood caries implicates novel genes.
21824479 2011 Unique utilization of a phosphoprotein phosphatase fold by a mammalian phosphodiesterase associated with WAGR syndrome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19060904 2009 An empirical framework for binary interactome mapping.
More...