Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.22
PubTator Score 3.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 5.6e-04
ependymoma 1.200 7.4e-12
group 3 medulloblastoma 1.500 1.0e-03
lung cancer 1.100 5.2e-03
medulloblastoma, large-cell 1.600 4.5e-05
osteosarcoma 1.396 1.8e-03
ovarian cancer -1.200 6.2e-05
primitive neuroectodermal tumor 1.400 8.6e-05

 GWAS Trait (1)

AA Sequence

MAEESRKPSAPSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPLGQEVFRLRFRQLRYQETLGPREALI      1 - 70
QLRALCHQWLRPDLNTKEQILELLVLEQFLTILPEELQTLVKEHQLENGEEVVTLLEDLERQIDILGRPV     71 - 140
SARVHGHRVLWEEVVHSASAPEPPNTQLQSEATQHKSPVPQESQERAMSTSQSPTRSQKGSSGDQEMTAT    141 - 210
LLTAGFQTLEKIEDMAVSLIREEWLLDPSQKDLCRDNRPENFRNMFSLGGETRSENRELASKQVISTGIQ    211 - 280
PHGETAAKCNGDVIRGLEHEEARDLLGRLERQRGNPTQERRHKCDECGKSFAQSSGLVRHWRIHTGEKPY    281 - 350
QCNVCGKAFSYRSALLSHQDIHNKVKRYHCKECGKAFSQNTGLILHQRIHTGEKPYQCNQCGKAFSQSAG    351 - 420
LILHQRIHSGERPYECNECGKAFSHSSHLIGHQRIHTGEKPYECDECGKTFRRSSHLIGHQRSHTGEKPY    421 - 490
KCNECGRAFSQKSGLIEHQRIHTGERPYKCKECGKAFNGNTGLIQHLRIHTGEKPYQCNECGKAFIQRSS    491 - 560
LIRHQRIHSGEKSESISV                                                        561 - 578
//

Text Mined References (17)

PMID Year Title