Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.63
PubTator Score 4.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 3.6e-05
Multiple myeloma 1332 4.3e-04

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.018 4.3e-04
ovarian cancer 2.300 3.6e-05

Synonym

Accession Q15773
Symbols NTN4

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVSPFGML      1 - 70
GMSGGFMDMFGMMNDMIGNMEHMTAGGNCQTFSSSTVISYSNTGDGAPKVYQETSEMRSAPGGIRETRRT     71 - 140
VRDSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAFDDEWRRETSRFRQQRPLE    141 - 210
FRRLESSGAGGRRAEGPPRLAIQGPEDSPSRQSRRYDW                                    211 - 248
//

Text Mined References (25)

PMID Year Title