Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.83
PubTator Score 4.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
periodontitis 269 3.41541668053518E-27
lung carcinoma 2844 3.31726547603522E-13
ovarian cancer 8492 7.08941641705706E-13
psoriasis 6685 5.77207339347513E-11
cystic fibrosis 1670 2.21481359605679E-6
Pick disease 1893 6.4133936787058E-5
osteosarcoma 7933 9.57619368488398E-5
interstitial cystitis 2299 1.26930411424878E-4
medulloblastoma, large-cell 6234 1.44043976920975E-4
ductal carcinoma in situ 1745 2.53807819690488E-4
lung cancer 4473 3.55327977143416E-4
atypical teratoid / rhabdoid tumor 4369 5.93588412316877E-4
primary Sjogren syndrome 789 9.83865890274682E-4
ulcerative colitis 2087 0.00317668327187635
pediatric high grade glioma 2712 0.00676378693136171
glioblastoma 5572 0.00736531993884274
spina bifida 1064 0.0256860345841234
mucosa-associated lymphoid tissue lymphoma 480 0.0287956176631188
sarcoidosis 368 0.0360710145845751

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma -1.071 0.000
glioblastoma -1.700 0.007
cystic fibrosis -2.409 0.000
periodontitis 1.200 0.000
atypical teratoid / rhabdoid tumor -1.700 0.001
medulloblastoma, large-cell -2.200 0.000
lung cancer 2.600 0.000
ulcerative colitis 1.800 0.003
sarcoidosis 1.100 0.036
interstitial cystitis 1.800 0.000
pediatric high grade glioma -1.200 0.007
primary Sjogren syndrome 1.300 0.001
psoriasis -1.500 0.000
lung carcinoma 1.500 0.000
spina bifida -1.974 0.026
Pick disease 1.100 0.000
mucosa-associated lymphoid tissue lympho... 1.602 0.029
ductal carcinoma in situ -1.500 0.000
ovarian cancer -2.700 0.000

Synonym

Accession Q15771 Q6FGK1 Q6MZH2 Q96CI8
Symbols

Gene

PDB

2EW1  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (2)

PMID Text
23615442 Data indicate taht the parasitophorous vacuole (PV), marked with Rab14, Rab30, or Rab43, colocalize with host-derived sphingolipids in the vacuolar space.
22188167 Rab30 is primarily expressed in the Golgi apparatus and is required for the structural integrity of this organelle.

AA Sequence

MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQER      1 - 70
FRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEF     71 - 140
SEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNFN           141 - 203
//

Text Mined References (17)

PMID Year Title
23615442 2013 Toxoplasma gondii salvages sphingolipids from the host Golgi through the rerouting of selected Rab vesicles to the parasitophorous vacuole.
23326517 2013 Insights into the genetic architecture of early stage age-related macular degeneration: a genome-wide association study meta-analysis.
22566634 2012 The genetic architecture of economic and political preferences.
22188167 2012 Rab30 is required for the morphological integrity of the Golgi apparatus.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9792283 1998 Small GTP-binding proteins in human endothelial cells.
8863739 1996 Molecular cloning of two novel rab genes from human melanocytes.