Property Summary

NCBI Gene PubMed Count 31
Grant Count 51
R01 Count 32
Funding $3,529,089.1
PubMed Score 61.72
PubTator Score 34.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
cutaneous lupus erythematosus -1.700 0.006
glioblastoma multiforme -1.200 0.000
oligodendroglioma -1.100 0.000
osteosarcoma 1.952 0.000
posterior fossa group A ependymoma 1.900 0.000
adult high grade glioma -1.100 0.025
invasive ductal carcinoma -1.050 0.005
Breast cancer -1.700 0.000
lung carcinoma 1.200 0.000
ovarian cancer -2.700 0.000
pituitary cancer 2.100 0.000

Gene RIF (14)

PMID Text
26687980 Findings suggest that EphrinB3 may be a relevant target for promoting remyelination in demyelinating disease
24615845 Data suggest that fusion of Nipah viruses with host cells is facilitated by two of viral membrane proteins, the G protein and the F protein; G head domain binds to human ephrins B2 and B3 altering conformational density of entire G head domain.
21447033 Ephrin-B3 binds to B lymphocytes, most likely via a non-classical receptor, and induces migration of the memory B cell subpopulation.
21413766 Phosphoproteomic profiling of nonsmall cell lung cancer cells reveals that ephrin B3 regulates pro-survival signaling through Akt1-mediated phosphorylation of the EphA2 receptor.
20925654 evidence for an unknown ephrin-B3-binding cell-surface proteoglycan involved in cellular signalling
20029409 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18632560 report the crystal structures of the NiV-G both in its receptor-unbound state and in complex with ephrin-B3, providing, to our knowledge, the first view of a paramyxovirus attachment complex in which a cellular protein is used as the virus receptor
More...

AA Sequence

MGPPHSGPGGVRVGALLLLGVLGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGP      1 - 70
HSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIAT     71 - 140
SDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSN    141 - 210
ATSRGAEGPLPPPSMPAVAGAAGGLALLLLGVAGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGG    211 - 280
GGMGPREAEPGELGIALRGGGAADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV              281 - 340
//

Text Mined References (33)

PMID Year Title
26687980 2016 Antibody-mediated neutralization of myelin-associated EphrinB3 accelerates CNS remyelination.
24615845 2014 Discerning intersecting fusion-activation pathways in the Nipah virus using machine learning.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21447033 2011 Ephrin-B3 binds specifically to B lymphocytes in blood and induces migration.
21413766 2011 Phosphoproteomic profiling of NSCLC cells reveals that ephrin B3 regulates pro-survival signaling through Akt1-mediated phosphorylation of the EphA2 receptor.
20925654 2011 Ephrin-B3 binds to a sulfated cell-surface receptor.
20029409 2010 Association of polymorphisms in the SLIT2 axonal guidance gene with anger in suicide attempters.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
More...