Property Summary

NCBI Gene PubMed Count 104
PubMed Score 229.37
PubTator Score 184.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 4.4e-03
hepatocellular carcinoma 1.100 1.3e-03
lung cancer 1.900 3.8e-04
lung carcinoma -2.000 4.9e-19
mucosa-associated lymphoid tissue lympho... 2.199 1.9e-02
osteosarcoma -2.240 5.0e-06
psoriasis 1.200 3.9e-40
tuberculosis and treatment for 3 months -1.100 4.8e-04

Gene RIF (98)

AA Sequence

MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMV      1 - 70
IRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHI     71 - 140
VSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIP    141 - 210
DVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRR    211 - 280
RERRDLFTESWDTQKAPNNYRSPISTSQPTNQSMDDTREDIYVNYPTFSRRPKTRV                  281 - 336
//

Text Mined References (107)

PMID Year Title