Property Summary

NCBI Gene PubMed Count 98
Grant Count 43
R01 Count 14
Funding $4,103,565.84
PubMed Score 208.16
PubTator Score 184.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.001
cutaneous lupus erythematosus 1.300 0.004
osteosarcoma -2.240 0.000
tuberculosis and treatment for 6 months -1.500 0.000
lung cancer 1.900 0.000
lung carcinoma -2.000 0.000
mucosa-associated lymphoid tissue lympho... 2.199 0.019
psoriasis 1.200 0.000

Gene RIF (92)

PMID Text
26675069 we propose that expression of DNAM-1 on inflammatory monocytes are evolutionally conserved and act as an adhesion molecule on blood inflammatory monocytes.
26634488 CD226 rs763361 polymorphism was significantly associated with susceptibility to T1D.
26359290 Effector and regulatory CD4+ memory T cells of healthy individuals carrying the predisposing CD226 variant showed, in comparison to carriers of the protective variant, reduced surface expression of CD226 and impaired induction of CD226 after stimulation.
26109642 upregulated CD226 expression on CD8(+) T cells reflects disease severity and is involved in Systemic sclerosis pathogenesis via the production of various cytokines, including profibrotic IL-13 and endothelial cell injury
25994968 Human regulatory T cells expressing the receptors TIGIT and CD226 display widely divergent phenotypes in regard to expansion and activation.
25991472 Age and CMV serostatus influence the expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated natural killer cells.
25950680 DNAM-1 ligands CD112 and CD155 as well as the NKG2D ligands MICA and MICB were expressed on the hiPSC lines
25854581 NKG2D and DNAM-1 receptor-ligand interactions were essential in cytolysis by resting NK cells, as simultaneous blocking of both pathways resulted in almost complete abrogation of the cytotoxicity.
25825444 the coordinated expression of LFA-1 and DNAM-1 is a central component of NK cell education and provides a potential mechanism for controlling cytotoxicity by functionally mature NK cells.
25818301 our data reveal the existence of a functional program of NK cell maturation marked by DNAM-1 expression.
More...

AA Sequence

MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMV      1 - 70
IRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHI     71 - 140
VSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIP    141 - 210
DVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRR    211 - 280
RERRDLFTESWDTQKAPNNYRSPISTSQPTNQSMDDTREDIYVNYPTFSRRPKTRV                  281 - 336
//

Text Mined References (102)

PMID Year Title
26755705 2016 Identification of CD112R as a novel checkpoint for human T cells.
26675069 2016 Expression of DNAM-1 (CD226) on inflammatory monocytes.
26634488 2015 Association of CD226 polymorphisms with the susceptibility to type 1 diabetes in Chinese children.
26359290 2015 Multiple sclerosis associated genetic variants of CD226 impair regulatory T cell function.
26109642 2015 Increased CD226 Expression on CD8+ T Cells Is Associated with Upregulated Cytokine Production and Endothelial Cell Injury in Patients with Systemic Sclerosis.
25994968 2015 Divergent Phenotypes of Human Regulatory T Cells Expressing the Receptors TIGIT and CD226.
25991472 2015 Expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated NK cells from healthy donors according to CMV-serostatus and age.
25950680 2015 Human Induced Pluripotent Stem Cells Are Targets for Allogeneic and Autologous Natural Killer (NK) Cells and Killing Is Partly Mediated by the Activating NK Receptor DNAM-1.
25854581 2015 Role of NKG2D, DNAM-1 and natural cytotoxicity receptors in cytotoxicity toward rhabdomyosarcoma cell lines mediated by resting and IL-15-activated human natural killer cells.
25825444 2015 Coordinated expression of DNAM-1 and LFA-1 in educated NK cells.
More...