Property Summary

Ligand Count 702
NCBI Gene PubMed Count 35
PubMed Score 36.88
PubTator Score 89.11

Knowledge Summary

Patent (5,876)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Obesity 678 3.278 1.6
Disease Target Count P-value
psoriasis 6694 6.3e-38
invasive ductal carcinoma 2951 5.3e-03
astrocytic glioma 2597 1.1e-02
ductal carcinoma in situ 1745 2.3e-02
oligodendroglioma 2850 4.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Spindle cell hemangioma 16 3.106 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 1.1e-02
ductal carcinoma in situ -1.500 2.3e-02
invasive ductal carcinoma -1.900 5.3e-03
oligodendroglioma -1.300 4.3e-02
psoriasis -1.600 6.3e-38

Gene RIF (26)

AA Sequence

MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKR      1 - 70
NQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRY     71 - 140
HMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIA    141 - 210
FTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYS    211 - 280
FIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHEL    281 - 350
RVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL    351 - 420
NPILYGFLNNGIKADLVSLIHCLHM                                                 421 - 445
//

Text Mined References (37)

PMID Year Title