Property Summary

NCBI Gene PubMed Count 35
PubMed Score 37.86
PubTator Score 89.11

Knowledge Summary

Patent (5,876)

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 0.011
oligodendroglioma -1.300 0.043
ductal carcinoma in situ -1.500 0.023
invasive ductal carcinoma -1.900 0.005
psoriasis -1.600 0.000

Synonym

Accession Q15761 Q6GTR7 Q92916 NPY5-R
Symbols NPYR5
NPY5-R
NPYY5-R

Gene

PANTHER Protein Class (2)

PDB

2HE6  

  TechDev Info (1)

Gene RIF (26)

PMID Text
25132261 NPY5R is an inducible pro-survival factor that is responsible for chemoresistance in neuroblastoma cells.
23932937 these data highlight a novel mechanism by which NPY may promote breast cancer progression, and further implicate a pathological role of the NPY Y5R.
23900445 Variations in genes AGRP, CPE, GHRL, GLP1R, HTR2A, NPY1R, NPY5R, SOCS3 and STAT3 showed modest associations with BMI in European Americans.
20797317 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20332211 Together, our results suggest that Y5R plays an important role in cancer cell growth and migration and could be a novel therapeutic target for breast cancer.
19874574 Observational study of gene-disease association. (HuGE Navigator)
19759915 NPY1R and NPY5R have roles in nutrient-specific food intake in Europeans
19759915 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKR      1 - 70
NQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRY     71 - 140
HMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIA    141 - 210
FTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYS    211 - 280
FIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHEL    281 - 350
RVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL    351 - 420
NPILYGFLNNGIKADLVSLIHCLHM                                                 421 - 445
//

Text Mined References (37)

PMID Year Title
25132261 2015 Neuropeptide Y receptor Y5 as an inducible pro-survival factor in neuroblastoma: implications for tumor chemoresistance.
24681953 2015 Persistent STAT5 activation in myeloid neoplasms recruits p53 into gene regulation.
23932937 2013 Neuropeptide Y Y5-receptor activation on breast cancer cells acts as a paracrine system that stimulates VEGF expression and secretion to promote angiogenesis.
23900445 2014 Genetic association analysis of 30 genes related to obesity in a European American population.
22029806 2011 Expression of Neuropeptide Y, Substance P, and their receptors in the right atrium of diabetic patients.
20797317 2010 Analysis of copy number variation in 8,842 Korean individuals reveals 39 genes associated with hepatic biomarkers AST and ALT.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20332211 2010 Neuropeptide Y Y5 receptor promotes cell growth through extracellular signal-regulated kinase signaling and cyclic AMP inhibition in a human breast cancer cell line.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
More...