Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 3.31

Knowledge Summary

Patent (2,364)

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 5.4e-08
Breast cancer 3578 5.5e-07
atypical teratoid / rhabdoid tumor 5112 1.1e-05
ependymoma 4679 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 1.1e-05
Breast cancer 1.100 5.5e-07
ependymoma -1.500 1.5e-02
ovarian cancer 1.700 5.4e-08

Gene RIF (2)

AA Sequence

MVFAHRMDNSKPHLIIPTLLVPLQNRSCTETATPLPSQYLMELSEEHSWMSNQTDLHYVLKPGEVATASI      1 - 70
FFGILWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTPFVLLQFTTGRWTLGSATCKV     71 - 140
VRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKAKKMIAASWVFDAGFVTPVLFFYGSNWDSHC    141 - 210
NYFLPSSWEGTAYTVIHFLVGFVIPSVLIILFYQKVIKYIWRIGTDGRTVRRTMNIVPRTKVKTIKMFLI    211 - 280
LNLLFLLSWLPFHVAQLWHPHEQDYKKSSLVFTAITWISFSSSASKPTLYSIYNANFRRGMKETFCMSSM    281 - 350
KCYRSNAYTITTSSRMAKKNYVGISEIPSMAKTITKDSIYDSFDREAKEKKLAWPINSNPPNTFV         351 - 415
//

Text Mined References (11)

PMID Year Title