Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 3.31

Knowledge Summary

Patent (2,364)

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.500 0.015
atypical teratoid / rhabdoid tumor -1.500 0.000
Breast cancer 1.100 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q15760
Symbols

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (1)

PMID Text
22912338 G protein-coupled receptor 19 (GPR19) was found frequently overexpressed in tissue samples obtained from patients with small cell lung cancer.

AA Sequence

MVFAHRMDNSKPHLIIPTLLVPLQNRSCTETATPLPSQYLMELSEEHSWMSNQTDLHYVLKPGEVATASI      1 - 70
FFGILWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTPFVLLQFTTGRWTLGSATCKV     71 - 140
VRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKAKKMIAASWVFDAGFVTPVLFFYGSNWDSHC    141 - 210
NYFLPSSWEGTAYTVIHFLVGFVIPSVLIILFYQKVIKYIWRIGTDGRTVRRTMNIVPRTKVKTIKMFLI    211 - 280
LNLLFLLSWLPFHVAQLWHPHEQDYKKSSLVFTAITWISFSSSASKPTLYSIYNANFRRGMKETFCMSSM    281 - 350
KCYRSNAYTITTSSRMAKKNYVGISEIPSMAKTITKDSIYDSFDREAKEKKLAWPINSNPPNTFV         351 - 415
//

Text Mined References (10)

PMID Year Title
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
22912338 2012 Expression of G protein-coupled receptor 19 in human lung cancer cells is triggered by entry into S-phase and supports G(2)-M cell-cycle progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10480372 Physical mapping of the G-protein coupled receptor 19 (GPR19) in the chromosome 12p12.3 region frequently rearranged in cancer cells.
8830667 1996 A novel gene codes for a putative G protein-coupled receptor with an abundant expression in brain.