Property Summary

NCBI Gene PubMed Count 93
Grant Count 47
R01 Count 37
Funding $3,142,535.22
PubMed Score 96.91
PubTator Score 91.90

Knowledge Summary

Patent (10,104)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.000 0.000
glioblastoma -1.700 0.000
medulloblastoma -1.200 0.001
medulloblastoma, large-cell -2.300 0.000
pediatric high grade glioma -1.300 0.000
pilocytic astrocytoma -1.200 0.000
posterior fossa group A ependymoma -1.100 0.000

Synonym

Accession Q15759 A8K730 B0LPG1 B7Z630 E7ETQ1 L7RT27 O00284 O15472 Q2XNF2 MAP kinase 11
Symbols P38B
SAPK2
p38-2
PRKM11
SAPK2B
p38Beta
P38BETA2

Gene

PDB

3GC8   3GC9   3GP0  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GO Component (2)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (39)

PMID Text
27029009 Suggest that R-Ras regulates angiogenic activities of endothelial cells in part via inhibition of the p38MAPK-HSP27 axis of VEGF signaling.
26270987 HIV-1 Vpr-mediated upregulation of CXCL8 (IL8) involves p38-MAPK11 (beta isoform of p38-MAPK) in astrocytes
26270987 HIV-1 Vpr-mediated upregulation of CXCL8 (IL8) involves p38-MAPK11 (beta isoform of p38-MAPK) in astrocytes
26075907 HIV-1 Vpr-mediated upregulation of CXCL8 (IL8) involves p38-MAPK11 (beta isoform of p38-MAPK) in astrocytes
25936522 These findings suggest that coronin 1A modulates endothelial cell apoptosis by regulating p38beta expression and activation.
25918994 The MAPK11 gene was variably methylated in monozygotic twins discordant for depressive disorder.
25066918 Data show that the p38 MAPK (p38) isoform (p38beta) mitogen-activated protein kinase 11 (MAPK11) is expressed in breast cancer cell.
25006254 study identified the structural motif responsible for the unique autophosphorylation capability of p38beta and the motif inhibiting this activity in living cells
24673557 Differential roles for p38alpha and p38beta in the HGF-induced expression of key osteogenic markers.
23807508 p38beta is a novel regulatory target of the transcription factor Pokemon and positively regulated by Pokemon in hepatic cells.
More...

AA Sequence

MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYR      1 - 70
ELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKY     71 - 140
IHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG    141 - 210
CIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPL    211 - 280
AIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKP    281 - 350
PEPPKPPGSLEIEQ                                                            351 - 364
//

Text Mined References (97)

PMID Year Title
27029009 2015 R-Ras Inhibits VEGF-Induced p38MAPK Activation and HSP27 Phosphorylation in Endothelial Cells.
25936522 2015 Coronin 1A depletion protects endothelial cells from TNF?-induced apoptosis by modulating p38? expression and activation.
25918994 2015 Genome-wide methylation study on depression: differential methylation and variable methylation in monozygotic twins.
25754930 2015 Up-regulation of galectin-9 induces cell migration in human dendritic cells infected with dengue virus.
25066918 2014 MAPK11 in breast cancer cells enhances osteoclastogenesis and bone resorption.
25006254 2014 The p38? mitogen-activated protein kinase possesses an intrinsic autophosphorylation activity, generated by a short region composed of the ?-G helix and MAPK insert.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24673557 2014 Hepatocyte growth factor and p38 promote osteogenic differentiation of human mesenchymal stem cells.
23807508 2013 p38?, A novel regulatory target of Pokemon in hepatic cells.
23625915 2013 Store-operated Ca2+ entry (SOCE) induced by protease-activated receptor-1 mediates STIM1 protein phosphorylation to inhibit SOCE in endothelial cells through AMP-activated protein kinase and p38? mitogen-activated protein kinase.
More...