Property Summary

NCBI Gene PubMed Count 65
PubMed Score 388.26
PubTator Score 168.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hartnup disease 13 4.217 2.1
Cancer 2499 3.759 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis -1.200 9.5e-03
lung cancer 2.100 2.5e-05
malignant mesothelioma 1.400 1.5e-06
Rheumatoid arthritis -1.100 1.3e-02
sonic hedgehog group medulloblastoma 1.500 1.3e-06

Protein-protein Interaction (10)

Gene RIF (46)

AA Sequence

MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGL      1 - 70
GVSGAGGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLDPGALGRLGAWALLFFLVTTL     71 - 140
LASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEE    141 - 210
RNITGTRVKVPVGQEVEGMNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVG    211 - 280
IMFLVAGKIVEMEDVGLLFARLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGT    281 - 350
SSSSATLPLMMKCVEENNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVT    351 - 420
ATASSVGAAGIPAGGVLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTE    421 - 490
SRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM                       491 - 541
//

Text Mined References (78)

PMID Year Title