Property Summary

NCBI Gene PubMed Count 56
Grant Count 60
R01 Count 29
Funding $7,453,307.09
PubMed Score 323.71
PubTator Score 168.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.013
malignant mesothelioma 1.400 0.000
lung cancer 2.100 0.000
interstitial cystitis -1.300 0.001
sonic hedgehog group medulloblastoma 1.500 0.000

Synonym

Accession Q15758 A8K9H5 B4DR77 B4DWS4 B7ZB81 D0EYG6 E9PC01 O95720 Q96RL9 Q9BWQ3 Q9UNP2 ATB(0)
Symbols R16
AAAT
ATBO
M7V1
RDRC
ASCT2
M7VS1

Gene

PANTHER Protein Class (2)

Gene RIF (37)

PMID Text
27129276 In the absence of SLC1A5 there is a crucial role of SNAT1 in supplying glutamine for glutaminolysis with SNAT2 acting as a "backup" for glutamine transport.
26936531 High expression of LAT1 and ASCT2 correlates with metastasis and invasion in esophageal squamous cell carcinoma.
26492990 Cys is a potent competitive inhibitor of hASCT2 but is not a substrate
26024742 LAT1, 4F2hc and ASCT2 were highly expressed in patients with advanced laryngeal cancer.
25987094 Genetic Variants in ASCT2 Gene are Associated with response to therapy in Hepatocelluar Carcinoma
25862406 The results demonstrate that N-glycosylation of SLC1A5 is critical for trafficking.
25693838 ASCT2-mediated glutamine uptake is essential for multiple pathways regulating the cell cycle and cell growth.
25631074 Cellular biotinylated solute carrier family 1 (neutral amino acid transporter), member 5 (SLC1A5) protein is incorporated into HIV-1 Gag virus-like particles
25337245 Report the differential expression of SLC1A5 in human colorectal cancer and normal tissues, and a functional link between SLC1A5 expression and growth and survival of colorectal cancer.
25142020 ASCT2 expression, which correlates with that of N-Myc and ATF4, is markedly elevated in high-stage neuroblastoma
More...

AA Sequence

MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGL      1 - 70
GVSGAGGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLDPGALGRLGAWALLFFLVTTL     71 - 140
LASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEE    141 - 210
RNITGTRVKVPVGQEVEGMNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVG    211 - 280
IMFLVAGKIVEMEDVGLLFARLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGT    281 - 350
SSSSATLPLMMKCVEENNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVT    351 - 420
ATASSVGAAGIPAGGVLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTE    421 - 490
SRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM                       491 - 541
//

Text Mined References (68)

PMID Year Title
27129276 2016 Deletion of Amino Acid Transporter ASCT2 (SLC1A5) Reveals an Essential Role for Transporters SNAT1 (SLC38A1) and SNAT2 (SLC38A2) to Sustain Glutaminolysis in Cancer Cells.
26936531 2016 Clinicopathological significance of LAT1 and ASCT2 in patients with surgically resected esophageal squamous cell carcinoma.
26492990 2015 Cysteine is not a substrate but a specific modulator of human ASCT2 (SLC1A5) transporter.
26024742 2015 Expression of Amino Acid Transporters (LAT1 and ASCT2) in Patients with Stage III/IV Laryngeal Squamous Cell Carcinoma.
25987094 2015 Genetic Variants in ASCT2 Gene are Associated with the Prognosis of Transarterial Chemoembolisation-Treated Early- Stage Hepatocelluar Carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25862406 2015 N-linked glycosylation of human SLC1A5 (ASCT2) transporter is critical for trafficking to membrane.
25759021 2015 Regulation of glutamine carrier proteins by RNF5 determines breast cancer response to ER stress-inducing chemotherapies.
25693838 2015 Targeting ASCT2-mediated glutamine uptake blocks prostate cancer growth and tumour development.
25337245 2014 Upregulated SLC1A5 promotes cell growth and survival in colorectal cancer.
More...