Property Summary

Ligand Count 3
NCBI Gene PubMed Count 65
PubMed Score 388.26
PubTator Score 168.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hartnup disease 13 4.217 2.1
Cancer 2499 3.759 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis -1.200 9.5e-03
lung cancer 2.100 2.5e-05
malignant mesothelioma 1.400 1.5e-06
Rheumatoid arthritis -1.100 1.3e-02
sonic hedgehog group medulloblastoma 1.500 1.3e-06

Protein-protein Interaction (10)

Gene RIF (46)

AA Sequence

MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGL      1 - 70
GVSGAGGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLDPGALGRLGAWALLFFLVTTL     71 - 140
LASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEE    141 - 210
RNITGTRVKVPVGQEVEGMNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVG    211 - 280
IMFLVAGKIVEMEDVGLLFARLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGT    281 - 350
SSSSATLPLMMKCVEENNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVT    351 - 420
ATASSVGAAGIPAGGVLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTE    421 - 490
SRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM                       491 - 541
//

Text Mined References (78)

PMID Year Title