Property Summary

NCBI Gene PubMed Count 60
Grant Count 40
R01 Count 30
Funding $2,087,603.06
PubMed Score 73.59
PubTator Score 19.19

Knowledge Summary

Patent (9,251)

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.180 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.500 0.000
medulloblastoma, large-cell -1.300 0.000
juvenile dermatomyositis -1.073 0.000
adult high grade glioma -1.400 0.001
non primary Sjogren syndrome sicca 1.200 0.014

Gene RIF (23)

PMID Text
26884850 TAK1/TAB1 expression in non-small cell lung carcinoma tissue is significantly increased and closely associated with patient clinical prognosis.
25549087 miR-29a repressed TAB1-mediated TIMP-1 production in dermal fibroblasts, demonstrating that miR-29a may be a therapeutic target in SSc.
25151490 Data indicate that mitogen-activated protein kinase (MAPK) p38 activation is triggered by AMP-activated protein kinases (AMPK) and mediated by TAB1 protein.
24462677 The amino acid sequence between positions 373 and 502 of TAB1 is required for TP interaction.
23825189 USP18 inhibits NF-kappaB and NFAT activation during Th17 differentiation by deubiquitinating the TAK1-TAB1 complex.
22972987 We found that endothelial TAK1 and TAB2, but not TAB1, were critically involved in vascular formation
22525462 TAK1 plays a critical role in accentuated epithelial to mesenchymal transition in obliterative bronchiolitis after lung transplantation.
22216226 data suggest a complex role of aa 452-457 of TAB1 in controlling p38 MAPK activity and subcellular localization and implicate these residues in TAK1- or p38 MAPK-dependent post-transcriptional control of gene expression
21159881 Phosphorylation and polyubiquitination of TAK1 are necessary for activation of NF-kappaB by the Kaposi's sarcoma-associated herpesvirus vGPCR.
20805296 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNG      1 - 70
YDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDDALAEKASLQSQLPEGVP     71 - 140
QHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTE    141 - 210
NEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDG    211 - 280
VTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERAR    281 - 350
FCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG    351 - 420
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRL    421 - 490
WSVDHGEQSVVTAP                                                            491 - 504
//

Text Mined References (69)

PMID Year Title
26884850 2015 Expression of TAK1/TAB1 expression in non-small cell lung carcinoma and adjacent normal tissues and their clinical significance.
25549087 2014 MiR-29a reduces TIMP-1 production by dermal fibroblasts via targeting TGF-? activated kinase 1 binding protein 1, implications for systemic sclerosis.
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25151490 2014 The kinase p38 activated by the metabolic regulator AMPK and scaffold TAB1 drives the senescence of human T cells.
24462677 2014 TAB1: a target of triptolide in macrophages.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23825189 2013 USP18 inhibits NF-?B and NFAT activation during Th17 differentiation by deubiquitinating the TAK1-TAB1 complex.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...