Property Summary

Ligand Count 10
NCBI Gene PubMed Count 114
PubMed Score 693.95
PubTator Score 649.69

Knowledge Summary

Patent (35,443)

TINX Plot

  Disease (8)

Expression

  Differential Expression (38)

Disease log2 FC p
acute quadriplegic myopathy 1.024 3.5e-03
adrenocortical carcinoma -1.846 1.0e-05
adult high grade glioma 1.400 4.3e-04
atypical teratoid / rhabdoid tumor 1.200 1.1e-03
autosomal dominant Emery-Dreifuss muscul... 1.455 3.2e-03
Breast cancer -1.300 1.8e-62
breast carcinoma -1.100 9.5e-03
colon cancer -1.100 3.1e-02
cystic fibrosis 1.600 1.1e-03
Duchenne muscular dystrophy 1.058 2.0e-04
gastric cancer 1.500 9.4e-03
glioblastoma 1.200 1.4e-03
group 4 medulloblastoma -2.300 5.3e-04
hepatocellular carcinoma 1.200 1.5e-02
intraductal papillary-mucinous adenoma (... -1.500 1.6e-03
intraductal papillary-mucinous carcinoma... -2.200 2.1e-03
intraductal papillary-mucinous neoplasm ... -2.000 4.9e-03
invasive ductal carcinoma -2.500 7.0e-03
juvenile dermatomyositis 1.414 2.6e-09
lung adenocarcinoma -1.700 3.5e-07
lung cancer -2.100 4.8e-05
lung carcinoma -1.400 4.0e-11
malignant mesothelioma -1.200 3.6e-06
medulloblastoma, large-cell 1.400 1.1e-04
non-small cell lung carcinoma -1.100 4.0e-20
osteosarcoma 1.051 3.3e-04
ovarian cancer 2.100 8.9e-10
pancreatic cancer 1.600 9.1e-04
pancreatic carcinoma 1.600 9.1e-04
pancreatic ductal adenocarcinoma liver m... -1.976 3.9e-03
Polycystic ovary syndrome -1.014 4.7e-02
posterior fossa group A ependymoma 1.700 3.4e-06
primitive neuroectodermal tumor -1.300 3.3e-02
psoriasis -1.100 5.6e-03
spina bifida -1.831 8.1e-03
tuberculosis 1.500 9.4e-04
ulcerative colitis -1.200 1.9e-02
urothelial carcinoma 3.400 2.7e-02

Gene RIF (83)

AA Sequence

MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNG      1 - 70
QPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTL     71 - 140
GDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVS    141 - 210
EKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVIS    211 - 280
KESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAA    281 - 350
RVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP    351 - 420
QSQEVKENQTVKFRCEVSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTRDSGTYSCTAS    421 - 490
NAQGQLSCSWTLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARST    491 - 560
CEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS    561 - 630
DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNS    631 - 700
AGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEV    701 - 770
LQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADG    771 - 840
GGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKTL    841 - 910
SEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPEKVPPPKPATPD    911 - 980
FRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPM    981 - 1050
GNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQ   1051 - 1120
VSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDA   1121 - 1190
PASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK   1191 - 1260
VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK   1261 - 1330
PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEY   1331 - 1400
KFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERL   1401 - 1470
GSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEI   1471 - 1540
VSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLAR   1541 - 1610
RLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDF   1611 - 1680
DDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGN   1681 - 1750
AVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEV   1751 - 1820
VEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGE   1821 - 1890
ATCTAELIVETMEEGEGEGEEEEE                                                 1891 - 1914
//

Text Mined References (126)

PMID Year Title