Property Summary

NCBI Gene PubMed Count 101
PubMed Score 679.37
PubTator Score 649.69

Knowledge Summary

Patent (35,443)

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
psoriasis 6685 2.42559464330901E-58
breast carcinoma 1614 1.98390332884365E-36
Breast cancer 3099 3.21580193557805E-27
non-small cell lung carcinoma 413 3.99697766435704E-20
lung carcinoma 2844 3.9704276946525E-11
lung adenocarcinoma 2714 2.61919030676137E-9
juvenile dermatomyositis 1189 2.63231934584578E-9
group 4 medulloblastoma 1875 1.30303330741564E-6
posterior fossa group A ependymoma 1511 3.41904663623612E-6
malignant mesothelioma 3163 3.58742199317934E-6
lung cancer 4473 1.22261771965552E-5
adrenocortical carcinoma 1427 2.05591282730708E-5
medulloblastoma, large-cell 6234 2.30109495462141E-5
colon cancer 1475 8.32343304203485E-5
ovarian cancer 8492 1.17407455384099E-4
atypical teratoid/rhabdoid tumor 1095 1.44787195226978E-4
Duchenne muscular dystrophy 602 1.97448153248662E-4
osteosarcoma 7933 3.33847403780004E-4
adult high grade glioma 2148 4.30108963382229E-4
primary pancreatic ductal adenocarcinoma 1271 5.26233350947555E-4
pancreatic cancer 2300 6.36012261657449E-4
tuberculosis 1563 9.37022091065039E-4
glioblastoma 5572 0.00144581632744791
pancreatic carcinoma 567 0.00192749401880785
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00319818478693904
acute quadriplegic myopathy 1157 0.00350958176099828
cystic fibrosis 1670 0.00403271197476938
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00522413235308467
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00689728170014217
invasive ductal carcinoma 2950 0.00697862187648933
spina bifida 1064 0.00811422598969312
gastric cancer 436 0.00941298068103946
hepatocellular carcinoma 550 0.0146112763120029
ulcerative colitis 2087 0.0191498721678553
urothelial carcinoma 318 0.0270727776496468
primitive neuroectodermal tumor 3031 0.0325059619158572
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0360046237533957
Polycystic Ovary Syndrome 335 0.0474803293284015
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Thoracic aortic aneurysm 13 3.682 1.8
Disease Target Count Z-score Confidence
Aortic aneurysm 34 0.0 4.0

Expression

Synonym

Accession Q15746 B4DUE3 D3DN97 O95796 O95797 O95798 O95799 Q14844 Q16794 Q17S15 Q3ZCP9 Q5MY99 Q5MYA0 Q6P2N0 Q7Z4J0 Q9C0L5 Q9UBG5 Q9UBY6 Q9UIT9 MLCK
Symbols KRP
AAT7
MLCK
MLCK1
MYLK1
smMLCK
MLCK108
MLCK210
MSTP083

Gene

PDB

2K0F   2CQV   2YR3  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (70)

PMID Text
26468005 We speculate that the drop of the ROCK-to-MLCK ratio may occur as an attempt to compensate for the increased Rho kinase activity.
26334299 study demonstrates that G. duodenalis-mediated disruption of villin is, at least, in part dependent on activation of myosin light chain kinase (MLCK).
26334100 TKS5 and MYLK represent two mediators of invasive behavior of cancer cells that are regulated by the ZEB1/miR-200 feedback loop
26147384 Gene-based association analyses shows nominal significant association with multifocal fibromuscular dysplasia for myosin light chain kinase.
26111161 These structure-function studies suggest novel mechanisms for nmMLCK regulation, which may confirm MYLK as a candidate gene in inflammatory lung disease and advance knowledge of the genetic underpinning of lung-related health disparities.
26025125 Fine mapping of the myosin light chain kinase (MYLK) gene replicates the association with asthma in populations of Spanish descent.
25696011 serum MLCK is associated with Type 2 diabetes mellitus.
25582918 inhibition of p38 MAP kinase attenuated the histamine response in all three EC types. Inhibition of RhoA, ROCK, or MLCK also prevented the histamine-induced decrease in TER in HDMEC.
25562159 Melatonin protects the esophageal epithelial barrier by suppressing the transcription, translation and activity of MLCK through ERK1/2 signal transduction
25483583 The Smooth muscle myosin light chain kinase (MLCK) contributes to Ca(2+) flux regulation in vascular smooth muscle (VSM) and in non-muscle cells, where cytoskeleton has been suggested to help Ca(2+) channels trafficking.
More...

AA Sequence

MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNG      1 - 70
QPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTL     71 - 140
GDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVS    141 - 210
EKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVIS    211 - 280
KESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAA    281 - 350
RVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP    351 - 420
QSQEVKENQTVKFRCEVSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTRDSGTYSCTAS    421 - 490
NAQGQLSCSWTLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARST    491 - 560
CEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS    561 - 630
DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNS    631 - 700
AGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEV    701 - 770
LQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADG    771 - 840
GGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKTL    841 - 910
SEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPEKVPPPKPATPD    911 - 980
FRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPM    981 - 1050
GNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQ   1051 - 1120
VSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDA   1121 - 1190
PASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK   1191 - 1260
VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK   1261 - 1330
PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEY   1331 - 1400
KFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERL   1401 - 1470
GSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEI   1471 - 1540
VSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLAR   1541 - 1610
RLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDF   1611 - 1680
DDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGN   1681 - 1750
AVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEV   1751 - 1820
VEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGE   1821 - 1890
ATCTAELIVETMEEGEGEGEEEEE                                                 1891 - 1914
//

Text Mined References (113)

PMID Year Title
26468005 2015 Inverse relationship of Rho kinase and myosin-light chain kinase expression in the aging human detrusor smooth muscle.
26334299 2015 Giardia duodenalis Surface Cysteine Proteases Induce Cleavage of the Intestinal Epithelial Cytoskeletal Protein Villin via Myosin Light Chain Kinase.
26334100 2015 The ZEB1/miR-200c feedback loop regulates invasion via actin interacting proteins MYLK and TKS5.
26147384 2015 Exome sequencing in seven families and gene-based association studies indicate genetic heterogeneity and suggest possible candidates for fibromuscular dysplasia.
26111161 2015 Structure-Function Analysis of the Non-Muscle Myosin Light Chain Kinase (nmMLCK) Isoform by NMR Spectroscopy and Molecular Modeling: Influence of MYLK Variants.
26025125 2015 Fine mapping of the myosin light chain kinase (MYLK) gene replicates the association with asthma in populations of Spanish descent.
25696011 2015 Serum myosin light chain kinase in type 2 diabetes mellitus: a cross-sectional study.
25582918 2015 Involvement of the H1 Histamine Receptor, p38 MAP Kinase, Myosin Light Chains Kinase, and Rho/ROCK in Histamine-Induced Endothelial Barrier Dysfunction.
25562159 2014 Melatonin protects the esophageal epithelial barrier by suppressing the transcription, expression and activity of myosin light chain kinase through ERK1/2 signal transduction.
25483583 2014 Regulation of calcium channels in smooth muscle: new insights into the role of myosin light chain kinase.
More...