Property Summary

NCBI Gene PubMed Count 50
Grant Count 46
R01 Count 20
Funding $3,596,841.82
PubMed Score 55.83
PubTator Score 103.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -4.668 0.000

Gene RIF (37)

PMID Text
26019275 A novel in-frame deletion in the leucine zipper domain of CEBPE leads to neutrophil-specific granule deficiency.
25938438 our study provided evidence that CEBPE rs2239633 variant is associated with decreased risk of childhood B-cell ALL in Europeans.
25761407 variants within IKZF1, ARID5B, and CEBPE were associated with increased acute lymphoblastic leukemia (ALL) risk, and the effects for ARID5B and CEBPE were most prominent in high-hyperdiploid ALL subtype in the California Hispanic population
25568349 During neutrophil development, acetylation of lysines 121 and 198 were found to be crucial for terminal neutrophil differentiation and the expression of neutrophil-specific granule proteins, including lactoferrin and collagenase.
25195121 Studies indicate that the CCAAT/enhancer binding protein-epsilon (CEBPE) rs2239633 polymorphism was significantly associated with childhood acute lymphoblastic leukemiaacute lymphoblastic leukemia (ALL) risk.
25005032 Data indicate no significant associations of transcription factors rs4132601 (IKZF1), rs7089424 (ARID5B) and rs2239633 (CEBPE) with risk of pediatric non-Hodgkin lymphoma (NHL).
24497567 Germline variants in IKZF1, ARID5B, and CEBPE as risk factors for adult-onset acute lymphoblastic leukemia: an analysis from the GMALL study group.
24398327 miR-130a is important for the regulation of the timed expression of C/EBP-epsilon during granulopoiesis.
24379003 The expression profiles of transcription factors, C/EBP(alpha, beta, epsilon) and PU.1 were further evaluated in the cells after treatment with ATRA and VPA.
23836053 study found that previously identified childhood acute lymphoblastic leukemia susceptibility loci in ARID5B and CEBPE show consistent risk effects across both Hispanic and non-Hispanic White populations, providing compelling supportive evidence for susceptibility at these loci
More...

AA Sequence

MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLK      1 - 70
GPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNP     71 - 140
LQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLR    141 - 210
RERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGC    211 - 280
S//

Text Mined References (50)

PMID Year Title
26019275 2015 A Novel In-Frame Deletion in the Leucine Zipper Domain of C/EBP? Leads to Neutrophil-Specific Granule Deficiency.
25938438 2015 Association between CEBPE Variant and Childhood Acute Leukemia Risk: Evidence from a Meta-Analysis of 22 Studies.
25761407 2015 Association of genetic variation in IKZF1, ARID5B, and CEBPE and surrogates for early-life infections with the risk of acute lymphoblastic leukemia in Hispanic children.
25568349 2015 Acetylation of C/EBP? is a prerequisite for terminal neutrophil differentiation.
25195121 2015 CEBPE polymorphism confers an increased risk of childhood acute lymphoblastic leukemia: a meta-analysis of 11 case-control studies with 5,639 cases and 10,036 controls.
25005032 2015 Childhood acute lymphoblastic leukemia-associated risk-loci IKZF1, ARID5B and CEBPE and risk of pediatric non-Hodgkin lymphoma: a report from the Berlin-Frankfurt-Münster Study Group.
24497567 2014 Germline variants in IKZF1, ARID5B, and CEBPE as risk factors for adult-onset acute lymphoblastic leukemia: an analysis from the GMALL study group.
24398327 2014 miRNA-130a regulates C/EBP-? expression during granulopoiesis.
24379003 2014 Enhancement of differentiation induction and upregulation of CCAAT/enhancer-binding proteins and PU.1 in NB4 cells treated with combination of ATRA and valproic acid.
23996088 2013 Variation at 10p12.2 and 10p14 influences risk of childhood B-cell acute lymphoblastic leukemia and phenotype.
More...