Property Summary

NCBI Gene PubMed Count 58
PubMed Score 57.37
PubTator Score 103.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -4.668 7.2e-10

 GO Component (2)

Gene RIF (44)

AA Sequence

MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLK      1 - 70
GPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNP     71 - 140
LQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLR    141 - 210
RERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGC    211 - 280
S//

Text Mined References (60)

PMID Year Title