Property Summary

NCBI Gene PubMed Count 24
Grant Count 27
R01 Count 18
Funding $4,567,885.59
PubMed Score 50.79
PubTator Score 35.21

Knowledge Summary

Patent (3,955)

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.162 0.005
tuberculosis and treatment for 3 months -1.400 0.000
breast carcinoma 1.500 0.000
fibroadenoma 1.100 0.007
sonic hedgehog group medulloblastoma 1.500 0.007
non primary Sjogren syndrome sicca 1.100 0.015
psoriasis 2.000 0.000
invasive ductal carcinoma 1.206 0.000

Gene RIF (14)

PMID Text
26206859 The deconstruction of OGR1-dependent signaling may aid our understanding of mucosal inflammation mechanisms
24375028 Provide evidence for the roles of OGR1 and ASIC1a in the regulation of intestinal passive Mg(2+) absorption.
23222714 the expression of OGR1 in myeloid-derived cells, especially in double positive cells, was required for prostate tumor cell-induced immunosuppression.
22835475 The involvement of ovarian cancer G-protein-coupled receptor 1 in acidic extracellular environment may be an underlying mechanism responsible for bone pain in osteoporosis or bone metastasis without clinically proved fractures.
22508039 OGR1 activation increased intracellular calcium in transfected HEK293 cells.
21907704 extracellular acidification induces CTGF production through the OGR1/G(q/11) protein and inositol-1,4,5-trisphosphate-induced Ca(2+) mobilization in human airway smooth muscle cells.
21740742 It indicated that OGR1 may be a tumor suppressor gene for ovarian cancer.
20622109 acidic pH-induced vascular actions of aortic smooth muscle cells can be dissected to OGR1-dependent and -independent pathways: COX-2 expression, PGI(2) production, and MKP-1 expression are mediated by OGR1, but PAI-1 expression is not.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18302504 OGR1/G(q/11)/phospholipase C/protein kinase C pathway regulates osteoblastic COX-2 induction and subsequent PGE(2) production in response to acidic circumstances
More...

AA Sequence

MGNITADNSSMSCTIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYLCNLTVADLFY      1 - 70
ICSLPFWLQYVLQHDNWSHGDLSCQVCGILLYENIYISVGFLCCISVDRYLAVAHPFRFHQFRTLKAAVG     71 - 140
VSVVIWAKELLTSIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLLASYQGILR    141 - 210
AVRRSHGTQKSRKDQIQRLVLSTVVIFLACFLPYHVLLLVRSVWEASCDFAKGVFNAYHFSLLLTSFNCV    211 - 280
ADPVLYCFVSETTHRDLARLRGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQT    281 - 350
PNSPGSGGFPTGRLA                                                           351 - 365
//

Text Mined References (28)

PMID Year Title
26206859 2015 The pH-sensing receptor OGR1 improves barrier function of epithelial cells and inhibits migration in an acidic environment.
24375028 2014 The roles of acid-sensing ion channel 1a and ovarian cancer G protein-coupled receptor 1 on passive Mg2+ transport across intestinal epithelium-like Caco-2 monolayers.
23222714 2014 Role of OGR1 in myeloid-derived cells in prostate cancer.
22835475 2012 Ovarian cancer G-protein-coupled receptor 1 induces the expression of the pain mediator prostaglandin E2 in response to an acidic extracellular environment in human osteoblast-like cells.
22508039 2012 The proton-activated G protein coupled receptor OGR1 acutely regulates the activity of epithelial proton transport proteins.
21907704 2011 Extracellular acidification induces connective tissue growth factor production through proton-sensing receptor OGR1 in human airway smooth muscle cells.
21740742 2011 Effects of ovarian cancer G protein coupled receptor 1 on the proliferation, migration, and adhesion of human ovarian cancer cells.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20622109 2010 Ovarian cancer G protein-coupled receptor 1-dependent and -independent vascular actions to acidic pH in human aortic smooth muscle cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...