Property Summary

NCBI Gene PubMed Count 31
PubMed Score 53.30
PubTator Score 35.21

Knowledge Summary

Patent (3,955)

Expression

  Differential Expression (8)

Disease log2 FC p
breast carcinoma 1.500 3.0e-06
fibroadenoma 1.100 7.2e-03
invasive ductal carcinoma 1.206 1.8e-04
non primary Sjogren syndrome sicca 1.100 1.5e-02
osteosarcoma -1.162 5.4e-03
psoriasis 1.400 1.2e-50
sonic hedgehog group medulloblastoma 1.500 7.4e-03
tuberculosis -1.300 4.8e-06

Gene RIF (17)

AA Sequence

MGNITADNSSMSCTIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYLCNLTVADLFY      1 - 70
ICSLPFWLQYVLQHDNWSHGDLSCQVCGILLYENIYISVGFLCCISVDRYLAVAHPFRFHQFRTLKAAVG     71 - 140
VSVVIWAKELLTSIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLLASYQGILR    141 - 210
AVRRSHGTQKSRKDQIQRLVLSTVVIFLACFLPYHVLLLVRSVWEASCDFAKGVFNAYHFSLLLTSFNCV    211 - 280
ADPVLYCFVSETTHRDLARLRGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQT    281 - 350
PNSPGSGGFPTGRLA                                                           351 - 365
//

Text Mined References (35)

PMID Year Title