Property Summary

NCBI Gene PubMed Count 45
PubMed Score 67.95
PubTator Score 49.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
malignant mesothelioma 3163 2.55935030926218E-7
osteosarcoma 7933 7.4891752428485E-7
atypical teratoid / rhabdoid tumor 4369 5.23756523732015E-4
psoriasis 6685 0.00348288559651702
Disease Target Count Z-score Confidence
Meningioma 27 3.704 1.9
Mesenchymal cell neoplasm 7 3.338 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
psoriasis 1.200 0.003
osteosarcoma 1.689 0.000
atypical teratoid / rhabdoid tumor 1.400 0.001

Synonym

Accession Q15742 B2RAK3 O76006 Q14797
Symbols MADER

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid

 GWAS Trait (1)

Pathway (1)

Gene RIF (28)

PMID Text
26883114 This study confirms that meningeal Meningeal solitary fibrous tumor and hemangiopericytoma represent a histopathologic continuum linked by STAT6 nuclear expression and NAB2-STAT6 fusion similar to their soft tissue counterparts.
26817999 Case Report: NAB2-STAT6 fusion in glioblastoma.
26686340 the majority of intrathoracic SFTs exhibited STAT6 nuclear staining, and NAB2ex4-STAT6ex2/3 was the predominant fusion type.
26226844 We delineate the common and rare NAB2-STAT6 fusion variants in solitary fibrous tumors
26136329 also identified NAB2-STAT6 fusions in two hemangiopericytomas diagnosed in the past with a common variant of NAB2ex6-STAT6ex16/17
25893823 It is associated with local recurrence and late distance metastasis of brain tumors to extracranial sites.
25667482 reverse transcriptase PCR analysis identified a nerve growth factor inducible-A binding protein 2-STAT6 gene fusion. Our case supports the utility of STAT6 immunohistochemistry as an adjunct in the diagnosis of soft-tissue SFT with loss of CD34 positivity
25582503 There was no association between solitary fibrous tumors with either NAB2 exon 4-STAT6 exon 2 or 3 fusion and tumors with other fusions regarding the frequency of mutations in the examined genes (P = .201).
25554652 This study validated the existence of the NAB2-STAT6 fusion gene in solitary fibrous tumors and examined its relation with pathological features.
24513261 Tumors with the most common fusion variant, NAB2ex4-STAT6ex2/3, corresponded to classic pleuropulmonary solitary fibrous tumors with diffuse fibrosis and mostly benign behavior and occurred in older patients
More...

AA Sequence

MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQ      1 - 70
QLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGS     71 - 140
MSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSPPFSP    141 - 210
PAGGGVPEGTGAGGLAAGGTGGGPDRLEPEMVRMVVESVERIFRSFPRGDAGEVTSLLKLNKKLARSVGH    211 - 280
IFEMDDNDSQKEEEIRKYSIIYGRFDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQV    281 - 350
ARESTYLSSLKGSRLHPEELGGPPLKKLKQEVGEQSHPEIQQPPPGPESYVPPYRPSLEEDSASLSGESL    351 - 420
DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAE    421 - 490
FEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ                                       491 - 525
//

Text Mined References (53)

PMID Year Title
26883114 2016 NAB2-STAT6 Gene Fusion in Meningeal Hemangiopericytoma and Solitary Fibrous Tumor.
26817999 2016 Case Report: Next generation sequencing identifies a NAB2-STAT6 fusion in Glioblastoma.
26686340 2016 The clinicopathological significance of NAB2-STAT6 gene fusions in 52 cases of intrathoracic solitary fibrous tumors.
26226844 2015 NAB2-STAT6 fusion types account for clinicopathological variations in solitary fibrous tumors.
26136329 2015 [Two Cases of Primary Intracranial Solitary Fibrous Tumor:Genetic Examination of <i>NAB2-STAT6</i> Fusion and Its Association with Hemangiopericytoma].
25893823 2015 NAB2-STAT6 fusion gene analysis in two cases of meningeal solitary fibrous tumor/hemangiopericytoma with late distant metastases.
25667482 2015 FDG PET/CT and MR imaging of CD34-negative soft-tissue solitary fibrous tumor with NAB2-STAT6 fusion gene.
25582503 2015 Distinct clinicopathological features of NAB2-STAT6 fusion gene variants in solitary fibrous tumor with emphasis on the acquisition of highly malignant potential.
25554652 2015 Malignant solitary fibrous tumor with high-grade nuclear atypia: an alternate entity for the undetermined tumor group.
25416956 2014 A proteome-scale map of the human interactome network.
More...