Property Summary

NCBI Gene PubMed Count 50
PubMed Score 72.63
PubTator Score 49.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Solitary Fibrous Tumors 2 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 2.6e-07
osteosarcoma 7950 7.5e-07
atypical teratoid / rhabdoid tumor 5112 5.2e-04
psoriasis 6694 3.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 3.17 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 5.2e-04
malignant mesothelioma 1.500 2.6e-07
osteosarcoma 1.689 7.5e-07
psoriasis 1.200 3.5e-03

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (33)

AA Sequence

MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQ      1 - 70
QLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGS     71 - 140
MSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSPPFSP    141 - 210
PAGGGVPEGTGAGGLAAGGTGGGPDRLEPEMVRMVVESVERIFRSFPRGDAGEVTSLLKLNKKLARSVGH    211 - 280
IFEMDDNDSQKEEEIRKYSIIYGRFDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQV    281 - 350
ARESTYLSSLKGSRLHPEELGGPPLKKLKQEVGEQSHPEIQQPPPGPESYVPPYRPSLEEDSASLSGESL    351 - 420
DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAE    421 - 490
FEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ                                       491 - 525
//

Text Mined References (59)

PMID Year Title