Property Summary

NCBI Gene PubMed Count 45
Grant Count 41
R01 Count 31
Funding $3,388,888.07
PubMed Score 67.95
PubTator Score 49.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
psoriasis 1.200 0.003
osteosarcoma 1.689 0.000
atypical teratoid / rhabdoid tumor 1.400 0.001

Gene RIF (28)

PMID Text
26883114 This study confirms that meningeal Meningeal solitary fibrous tumor and hemangiopericytoma represent a histopathologic continuum linked by STAT6 nuclear expression and NAB2-STAT6 fusion similar to their soft tissue counterparts.
26817999 Case Report: NAB2-STAT6 fusion in glioblastoma.
26686340 the majority of intrathoracic SFTs exhibited STAT6 nuclear staining, and NAB2ex4-STAT6ex2/3 was the predominant fusion type.
26226844 We delineate the common and rare NAB2-STAT6 fusion variants in solitary fibrous tumors
26136329 also identified NAB2-STAT6 fusions in two hemangiopericytomas diagnosed in the past with a common variant of NAB2ex6-STAT6ex16/17
25893823 It is associated with local recurrence and late distance metastasis of brain tumors to extracranial sites.
25667482 reverse transcriptase PCR analysis identified a nerve growth factor inducible-A binding protein 2-STAT6 gene fusion. Our case supports the utility of STAT6 immunohistochemistry as an adjunct in the diagnosis of soft-tissue SFT with loss of CD34 positivity
25582503 There was no association between solitary fibrous tumors with either NAB2 exon 4-STAT6 exon 2 or 3 fusion and tumors with other fusions regarding the frequency of mutations in the examined genes (P = .201).
25554652 This study validated the existence of the NAB2-STAT6 fusion gene in solitary fibrous tumors and examined its relation with pathological features.
24513261 Tumors with the most common fusion variant, NAB2ex4-STAT6ex2/3, corresponded to classic pleuropulmonary solitary fibrous tumors with diffuse fibrosis and mostly benign behavior and occurred in older patients
More...

AA Sequence

MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQ      1 - 70
QLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGS     71 - 140
MSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSPPFSP    141 - 210
PAGGGVPEGTGAGGLAAGGTGGGPDRLEPEMVRMVVESVERIFRSFPRGDAGEVTSLLKLNKKLARSVGH    211 - 280
IFEMDDNDSQKEEEIRKYSIIYGRFDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQV    281 - 350
ARESTYLSSLKGSRLHPEELGGPPLKKLKQEVGEQSHPEIQQPPPGPESYVPPYRPSLEEDSASLSGESL    351 - 420
DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAE    421 - 490
FEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ                                       491 - 525
//

Text Mined References (53)

PMID Year Title
26883114 2016 NAB2-STAT6 Gene Fusion in Meningeal Hemangiopericytoma and Solitary Fibrous Tumor.
26817999 2016 Case Report: Next generation sequencing identifies a NAB2-STAT6 fusion in Glioblastoma.
26686340 2016 The clinicopathological significance of NAB2-STAT6 gene fusions in 52 cases of intrathoracic solitary fibrous tumors.
26226844 2015 NAB2-STAT6 fusion types account for clinicopathological variations in solitary fibrous tumors.
26136329 2015 [Two Cases of Primary Intracranial Solitary Fibrous Tumor:Genetic Examination of <i>NAB2-STAT6</i> Fusion and Its Association with Hemangiopericytoma].
25893823 2015 NAB2-STAT6 fusion gene analysis in two cases of meningeal solitary fibrous tumor/hemangiopericytoma with late distant metastases.
25667482 2015 FDG PET/CT and MR imaging of CD34-negative soft-tissue solitary fibrous tumor with NAB2-STAT6 fusion gene.
25582503 2015 Distinct clinicopathological features of NAB2-STAT6 fusion gene variants in solitary fibrous tumor with emphasis on the acquisition of highly malignant potential.
25554652 2015 Malignant solitary fibrous tumor with high-grade nuclear atypia: an alternate entity for the undetermined tumor group.
25416956 2014 A proteome-scale map of the human interactome network.
More...