Property Summary

NCBI Gene PubMed Count 13
PubMed Score 66.84
PubTator Score 31.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.388056475038E-11
atypical teratoid / rhabdoid tumor 4369 1.93422636797764E-11
pediatric high grade glioma 2712 7.79985776477319E-10
pilocytic astrocytoma 3086 1.64283940603078E-9
glioblastoma 5572 3.06135601735949E-8
sonic hedgehog group medulloblastoma 1482 5.75319129315796E-7
medulloblastoma, large-cell 6234 2.07707179232555E-6
pituitary cancer 1972 1.42842961708551E-5
primitive neuroectodermal tumor 3031 4.1805733607577E-4
active Crohn's disease 918 0.012205733553867
Disease Target Count Z-score Confidence
Retinopathy of prematurity 21 4.318 2.2
Oculocerebrorenal syndrome 24 3.085 1.5

Expression

Synonym

Accession Q15735 B3KS54 Q32M61 Q6ZTH6 Q8N902 Q9UDT9
Symbols PIPP
INPP5
PIB5PA

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow EggNOG Inparanoid
Platypus OMA Inparanoid

Gene RIF (4)

PMID Text
26282217 Suggest miR-661 functions as a tumor promoter by targeting the INPP5J gene, and then promoting cell proliferation of ovarian cancer cells.
26267533 Findings indicate inositol polyphosphate 5-phosphatase PIPP (INPP5J) as a suppressor of oncogenic phosphoinositide 3-kinase (PI3K)/AKT signaling in breast cancer.
25099196 miR-508 has a role in sustaining phosphoinositide signalling and promotes aggressive phenotype of oesophageal squamous cell carcinoma by suppressing INPP5J
23443536 these results establish the tumour suppressive role of phosphatidylinositol 4,5-bisphosphate 5-phosphatase and reveal mechanisms involved in its downregulation in melanoma.

AA Sequence

MEGQSSRGSRRPGTRAGLGSLPMPQGVAQTGAPSKVDSSFQLPAKKNAALGPSEPRLALAPVGPRAAMSA      1 - 70
SSEGPRLALASPRPILAPLCTPEGQKTATAHRSSSLAPTSVGQLVMSASAGPKPPPATTGSVLAPTSLGL     71 - 140
VMPASAGPRSPPVTLGPNLAPTSRDQKQEPPASVGPKPTLAASGLSLALASEEQPPELPSTPSPVPSPVL    141 - 210
SPTQEQALAPASTASGAASVGQTSARKRDAPAPRPLPASEGHLQPPAQTSGPTGSPPCIQTSPDPRLSPS    211 - 280
FRARPEALHSSPEDPVLPRPPQTLPLDVGQGPSEPGTHSPGLLSPTFRPGAPSGQTVPPPLPKPPRSPSR    281 - 350
SPSHSPNRSPCVPPAPDMALPRLGTQSTGPGRCLSPNLQAQEAPAPVTTSSSTSTLSSSPWSAQPTWKSD    351 - 420
PGFRITVVTWNVGTAMPPDDVTSLLHLGGGDDSDGADMIAIGLQEVNSMLNKRLKDALFTDQWSELFMDA    421 - 490
LGPFNFVLVSSVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCH    491 - 560
LPAHMDKAEQRKDNFQTILSLQQFQGPGAQGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSDQLHQLWE    561 - 630
KDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAPGGGPSPSGRKS    631 - 700
HRLQVTQHSYRSHMEYTVSDHKPVAAQFLLQFAFRDDMPLVRLEVADEWVRPEQAVVRYRMETVFARSSW    701 - 770
DWIGLYRVGFRHCKDYVAYVWAKHEDVDGNTYQVTFSEESLPKGHGDFILGYYSHNHSILIGITEPFQIS    771 - 840
LPSSELASSSTDSSGTSSEGEDDSTLELLAPKSRSPSPGKSKRHRSRSPGLARFPGLALRPSSRERRGAS    841 - 910
RSPSPQSRRLSRVAPDRSSNGSSRGSSEEGPSGLPGPWAFPPAVPRSLGLLPALRLETVDPGGGGSWGPD    911 - 980
REALAPNSLSPSPQGHRGLEEGGLGP                                                981 - 1006
//

Text Mined References (14)

PMID Year Title
26282217 2015 MiR-661 contributed to cell proliferation of human ovarian cancer cells by repressing INPP5J expression.
26267533 2015 The Inositol Polyphosphate 5-Phosphatase PIPP Regulates AKT1-Dependent Breast Cancer Growth and Metastasis.
25416956 2014 A proteome-scale map of the human interactome network.
25099196 2014 miR-508 sustains phosphoinositide signalling and promotes aggressive phenotype of oesophageal squamous cell carcinoma.
23443536 2013 PI(4,5)P2 5-phosphatase A regulates PI3K/Akt signalling and has a tumour suppressive role in human melanoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12536145 2003 Identification of a novel domain in two mammalian inositol-polyphosphate 5-phosphatases that mediates membrane ruffle localization. The inositol 5-phosphatase skip localizes to the endoplasmic reticulum and translocates to membrane ruffles following epidermal growth factor stimulation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...