Property Summary

NCBI Gene PubMed Count 13
PubMed Score 73.26
PubTator Score 31.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease -1.114 1.2e-02
adult high grade glioma -1.400 3.4e-06
Astrocytoma, Pilocytic -1.500 2.9e-10
atypical teratoid / rhabdoid tumor -1.700 1.9e-11
ependymoma -1.400 9.8e-15
glioblastoma -1.300 3.9e-11
group 4 medulloblastoma -1.400 1.3e-06
medulloblastoma, large-cell -1.700 2.1e-06
pituitary cancer 1.400 1.4e-05
primitive neuroectodermal tumor -1.100 4.2e-04

Gene RIF (4)

AA Sequence

MEGQSSRGSRRPGTRAGLGSLPMPQGVAQTGAPSKVDSSFQLPAKKNAALGPSEPRLALAPVGPRAAMSA      1 - 70
SSEGPRLALASPRPILAPLCTPEGQKTATAHRSSSLAPTSVGQLVMSASAGPKPPPATTGSVLAPTSLGL     71 - 140
VMPASAGPRSPPVTLGPNLAPTSRDQKQEPPASVGPKPTLAASGLSLALASEEQPPELPSTPSPVPSPVL    141 - 210
SPTQEQALAPASTASGAASVGQTSARKRDAPAPRPLPASEGHLQPPAQTSGPTGSPPCIQTSPDPRLSPS    211 - 280
FRARPEALHSSPEDPVLPRPPQTLPLDVGQGPSEPGTHSPGLLSPTFRPGAPSGQTVPPPLPKPPRSPSR    281 - 350
SPSHSPNRSPCVPPAPDMALPRLGTQSTGPGRCLSPNLQAQEAPAPVTTSSSTSTLSSSPWSAQPTWKSD    351 - 420
PGFRITVVTWNVGTAMPPDDVTSLLHLGGGDDSDGADMIAIGLQEVNSMLNKRLKDALFTDQWSELFMDA    421 - 490
LGPFNFVLVSSVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCH    491 - 560
LPAHMDKAEQRKDNFQTILSLQQFQGPGAQGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSDQLHQLWE    561 - 630
KDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAPGGGPSPSGRKS    631 - 700
HRLQVTQHSYRSHMEYTVSDHKPVAAQFLLQFAFRDDMPLVRLEVADEWVRPEQAVVRYRMETVFARSSW    701 - 770
DWIGLYRVGFRHCKDYVAYVWAKHEDVDGNTYQVTFSEESLPKGHGDFILGYYSHNHSILIGITEPFQIS    771 - 840
LPSSELASSSTDSSGTSSEGEDDSTLELLAPKSRSPSPGKSKRHRSRSPGLARFPGLALRPSSRERRGAS    841 - 910
RSPSPQSRRLSRVAPDRSSNGSSRGSSEEGPSGLPGPWAFPPAVPRSLGLLPALRLETVDPGGGGSWGPD    911 - 980
REALAPNSLSPSPQGHRGLEEGGLGP                                                981 - 1006
//

Text Mined References (14)

PMID Year Title