Property Summary

NCBI Gene PubMed Count 208
Grant Count 281
R01 Count 126
Funding $24,783,286.07
PubMed Score 794.57
PubTator Score 335.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
cystic fibrosis -1.432 0.001
psoriasis -1.100 0.019

Synonym

Accession Q15726 A8K6N0 Q9HBP1
Symbols HH13
KiSS-1

Gene

Gene RIF (186)

PMID Text
26831552 Data suggest that plasma kisspeptin and serum prolactin levels may be involved in the physiopathology of breast enlargement in newborns.
26809635 KiSS-1 downregulation may play a role in tumor progression and metastasis of oral squamous cell carcinoma, and may be a reliable biomarker for predicting clinical outcome in this disease.
26572251 KiSS1 is a metastasis suppressor gene of pancreatic cancer, and this suppression is not dependent on the expression levels of GPR54.
26510589 A number of mutations in KISS1 KISS1R are associated with central precocious puberty and isolated hypogonadotropic hypogonadism. (Review)
26471489 KISS1 Low Expression Correlates with Colorectal Liver Metastasis.
26384646 On D4 of pregnancy, the Kiss 1 null uterus expresses functional KISS1R molecules.
26183891 These findings are of tremendous significance and will greatly shape how KISS1 will be developed as a therapeutic agent in augmenting the reproductive potential of both women and important livestock species--{REVIEW}
26010933 KISS1 expression in the primary site of colorectal cancer could become a useful marker, with its increased levels indicating an advanced disease and a worse prognosis.
25810563 rs5780218 polymorphism individually confers susceptibility for development of breast cancer in Mexican population.
25783047 The results suggest that mutations in the coding sequence of KISS1 are not common in patients with IHH in this Chinese population.
More...

AA Sequence

MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAATARLSRRGTS      1 - 70
LSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRFGKREAAPGNHGRSAGRG       71 - 138
//

Text Mined References (208)

PMID Year Title
26831552 2015 Plasma Kisspeptin Levels in Newborn Infants with Breast Enlargement.
26809635 2016 KiSS-1 expression in oral squamous cell carcinoma and its prognostic significance.
26572251 2016 KiSS?1?mediated suppression of the invasive ability of human pancreatic carcinoma cells is not dependent on the level of KiSS?1 receptor GPR54.
26510589 [Kisspeptin and leptin in the regulation of fertility].
26471489 2015 KISS1 Associates with Better Outcome via Inhibiting Matrix Metalloproteinase-9 in Colorectal Liver Metastasis.
26384646 2015 The pregnant mouse uterus exhibits a functional kisspeptin/KISS1R signaling system on the day of embryo implantation.
26183891 2015 Uterine and placental KISS1 regulate pregnancy: what we know and the challenges that lie ahead.
26010933 2015 A clinicopathological analysis of KISS1 and KISS1R expression in colorectal cancer.
25810563 2015 Polymorphisms rs12998 and rs5780218 in KiSS1 suppressor metastasis gene in Mexican patients with breast cancer.
25783047 2015 Mutations in KISS1 are not responsible for idiopathic hypogonadotropic hypogonadism in Chinese patients.
More...