Property Summary

NCBI Gene PubMed Count 223
PubMed Score 894.76
PubTator Score 335.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
malignant mesothelioma 3232 1.7e-06
cystic fibrosis 1695 5.9e-04
psoriasis 6694 1.9e-02
Disease Target Count Z-score Confidence
Klinefelter's syndrome 56 0.0 4.0
Disease Target Count
Hypogonadotropic hypogonadism 89

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -1.432 5.9e-04
malignant mesothelioma 1.900 1.7e-06
psoriasis -1.100 1.9e-02

Protein-protein Interaction (6)

Gene RIF (201)

AA Sequence

MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAATARLSRRGTS      1 - 70
LSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRFGKREAAPGNHGRSAGRG       71 - 138
//

Text Mined References (223)

PMID Year Title