Property Summary

NCBI Gene PubMed Count 16
Grant Count 153
R01 Count 116
Funding $13,040,057.92
PubMed Score 96.42
PubTator Score 33.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 1.300 0.000
tuberculosis and treatment for 6 months 1.100 0.000
acute myeloid leukemia 1.100 0.016

Synonym

Accession Q15723 E9PCX3 Q15724 Q15725 Q6P1K5
Symbols EU32
NERF
NERF-2
NERF-1A
NERF-1B
NERF-1a,b

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
18754678 Affinity of the CAL PDZ domain for the cystic fibrosis transmembrane conductance regulator (CFTR) C-terminus is much weaker than that of the NHERF1/NHERF2 domains, enabling wild-type CFTR to avoid premature entrapment in the lysosomal pathway.
18544453 ELF2 transactivates VCP promoter through binding to two motifs, with a predominant contribution of the upstream one.
17368566 These findings indicate that ELF2/NERF promotes VCP transcription and that ELF2/NERF-VCP pathway might be important for cell survival and proliferation under cytokine stress.
14970218 NERF/ELF-2 physically interacts with AML1 and mediates opposing effects on AML1-mediated transcription of the B cell-specific blk gene
12447867 Observational study of gene-environment interaction. (HuGE Navigator)
11967990 angiopoietin-1 regulates expression of NERF2 and its own receptor in hypoxic cells.

AA Sequence

MTSAVVDSGGTILELSSNGVENQEESEKVSEYPAVIVEPVPSARLEQGYAAQVLVYDDETYMMQDVAEEQ      1 - 70
EVETENVETVEASVHSSNAHCTDKTIEAAEALLHMESPTCLRDSRSPVEVFVPPCVSTPEFIHAAMRPDV     71 - 140
ITETVVEVSTEESEPMDTSPIPTSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKPREGKGNTTYL    141 - 210
WEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKV    211 - 280
EGQRLVYQFKDMPKNIVVIDDDKSETCNEDLAGTTDEKSLERVSLSAESLLKAASSVRSGKNSSPINCSR    281 - 350
AEKGVARVVNITSPGHDASSRSPTTTASVSATAAPRTVRVAMQVPVVMTSLGQKISTVAVQSVNAGAPLI    351 - 420
TSTSPTTATSPKVVIQTIPTVMPASTENGDKITMQPAKIITIPATQLAQCQLQTKSNLTGSGSINIVGTP    421 - 490
LAVRALTPVSIAHGTPVMRLSMPTQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEEKPAD    491 - 560
GNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK                                         561 - 593
//

Text Mined References (25)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24992036 2014 G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19674970 2009 Critical role for GATA3 in mediating Tie2 expression and function in large vessel endothelial cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18754678 2008 The relative binding affinities of PDZ partners for CFTR: a biochemical basis for efficient endocytic recycling.
More...