Property Summary

NCBI Gene PubMed Count 18
PubMed Score 106.42
PubTator Score 33.15

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia 1.100 1.6e-02
group 3 medulloblastoma 1.100 4.7e-03
tuberculosis and treatment for 6 months 1.100 1.9e-06

Gene RIF (8)

AA Sequence

MTSAVVDSGGTILELSSNGVENQEESEKVSEYPAVIVEPVPSARLEQGYAAQVLVYDDETYMMQDVAEEQ      1 - 70
EVETENVETVEASVHSSNAHCTDKTIEAAEALLHMESPTCLRDSRSPVEVFVPPCVSTPEFIHAAMRPDV     71 - 140
ITETVVEVSTEESEPMDTSPIPTSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKPREGKGNTTYL    141 - 210
WEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKV    211 - 280
EGQRLVYQFKDMPKNIVVIDDDKSETCNEDLAGTTDEKSLERVSLSAESLLKAASSVRSGKNSSPINCSR    281 - 350
AEKGVARVVNITSPGHDASSRSPTTTASVSATAAPRTVRVAMQVPVVMTSLGQKISTVAVQSVNAGAPLI    351 - 420
TSTSPTTATSPKVVIQTIPTVMPASTENGDKITMQPAKIITIPATQLAQCQLQTKSNLTGSGSINIVGTP    421 - 490
LAVRALTPVSIAHGTPVMRLSMPTQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEEKPAD    491 - 560
GNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK                                         561 - 593
//

Text Mined References (27)

PMID Year Title