Property Summary

NCBI Gene PubMed Count 60
Grant Count 290
R01 Count 129
Funding $62,022,182.36
PubMed Score 513.67
PubTator Score 170.62

Knowledge Summary

Patent (18,754)

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.600 0.000
osteosarcoma -4.082 0.000
Atopic dermatitis 1.400 0.001
tuberculosis 1.900 0.000

Synonym

Accession Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 LTB4-R 1
Symbols BLT1
BLTR
P2Y7
GPR16
LTBR1
P2RY7
CMKRL1
LTB4R1

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (47)

PMID Text
26497676 Induction of pSmad3L through BLT1-NOX-ROS-EGFR-PI3K-ERK1/2 signaling pathway is a key mechanism by which LTB4 blocks the anti-proliferative responses of TGF-beta1 in breast tumors.
26371243 The BLT1 Inhibitory Function of alpha-1 Antitrypsin Augmentation Therapy Disrupts Leukotriene B4 Neutrophil Signaling.
26248046 pro-inflammatory stimuli lead to FPR2/ALX expression while LXA4 induces an anti-inflammatory response
25323785 Results suggest that NOX2-derived ROS-mediated BLT1 trafficking to the cell surface plays a key role in the exocytosis of human eosinophils induced by LTB4.
24975656 increased levels in Chinese children with sleep-disordered breathing
24663678 we show that orchestrated action of CXCR2 and leukotriene B4 receptor BLT1 plays a key role in neutrophil recruitment during the development of imiquimod (IMQ)-induced psoriatic skin lesions in mice
23304088 A novel method predicts activated structures of G-protein-coupled receptor BLT1 with high accuracy, while aiming for the use of the predicted 3D structures in in silico virtual screening.
23167751 LTB4R1 shows splice variation in the 5'-untranslated region and multiple promoter regions. LTB4R1 polymorphisms do not appear to be susceptibility markers for the development of asthma in Caucasian subjects.
23137534 The LTB(4)-BLT signaling pathway may negatively regulate preadipocyte differentiation via induction of TGFBI expression as a rate-limiting system to control adipocyte differentiation.
22707565 Helix 8 of BLT1 inhibits receptor internalization by suppressing the excessive phosphorylation of the C-terminal tail.
More...

AA Sequence

MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLT      1 - 70
APFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAG     71 - 140
IWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQA    141 - 210
RRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSV    211 - 280
NPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNE    281 - 350
LN                                                                        351 - 352
//

Text Mined References (60)

PMID Year Title
26497676 2015 The proinflammatory LTB4/BLT1 signal axis confers resistance to TGF-?1-induced growth inhibition by targeting Smad3 linker region.
26371243 2015 The BLT1 Inhibitory Function of ?-1 Antitrypsin Augmentation Therapy Disrupts Leukotriene B4 Neutrophil Signaling.
26248046 2015 Differential regulation of monocytic expression of leukotriene and lipoxin receptors.
25323785 2014 NOX2-derived ROS-mediated surface translocation of BLT1 is essential for exocytosis in human eosinophils induced by LTB4.
24975656 2014 Serum leukotrienes, circulating neutrophils, and high sensitivity C-reactive protein in Chinese children with sleep-disordered breathing.
24663678 2014 Interplay between CXCR2 and BLT1 facilitates neutrophil infiltration and resultant keratinocyte activation in a murine model of imiquimod-induced psoriasis.
24571439 2014 Genome-wide association analyses of child genotype effects and parent-of-origin effects in specific language impairment.
23304088 2012 Novel computational methodologies for structural modeling of spacious ligand binding sites of G-protein-coupled receptors: development and application to human leukotriene B4 receptor.
23167751 2012 Leukotriene B4 receptor locus gene characterisation and association studies in asthma.
23137534 2012 Role of leukotriene B? receptor signaling in human preadipocyte differentiation.
More...