Property Summary

Ligand Count 176
NCBI Gene PubMed Count 63
PubMed Score 557.56
PubTator Score 170.62

Knowledge Summary

Patent (18,754)

Expression

  Differential Expression (4)

Disease log2 FC p
Atopic dermatitis 1.300 2.1e-04
osteosarcoma -1.935 8.7e-06
psoriasis 1.500 4.8e-06
tuberculosis 1.900 8.6e-06

 CSPA Cell Line (1)

Gene RIF (50)

AA Sequence

MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLT      1 - 70
APFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAG     71 - 140
IWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQA    141 - 210
RRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSV    211 - 280
NPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNE    281 - 350
LN                                                                        351 - 352
//

Text Mined References (63)

PMID Year Title