Property Summary

NCBI Gene PubMed Count 301
Grant Count 281
R01 Count 199
Funding $21,729,716.38
PubMed Score 539.08
PubTator Score 433.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.127 0.009
Multiple myeloma 1.498 0.005
astrocytoma 2.600 0.000
glioblastoma -2.500 0.000
osteosarcoma -2.930 0.000
ependymoma -2.100 0.000
group 3 medulloblastoma 1.500 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell 2.000 0.000
primitive neuroectodermal tumor 1.400 0.000
lung cancer 1.300 0.002
breast carcinoma 1.200 0.001
Breast cancer 2.300 0.033
pediatric high grade glioma -1.900 0.000
pilocytic astrocytoma -1.600 0.000
subependymal giant cell astrocytoma -2.565 0.018
lung adenocarcinoma 1.215 0.000
ovarian cancer 1.600 0.004

Synonym

Accession Q15717 B4DVB8 Q53XN6 Q9BTT1
Symbols HUR
Hua
MelG
ELAV1

Gene

PDB

3HI9   4ED5   4EGL   4FXV  

Gene RIF (284)

PMID Text
27401462 Results indicate that HuR induces 14-3-3zeta translation via interaction with its 3' UTR and that 14-3-3zeta is necessary for stimulation of intestinal epithelial cell migration after wounding.
27215092 Reduction of miR-31 expression enhanced lung cancer proliferation and migration by repressing HuR expression
26898797 MiR-9 directly targets ELAVL1 in ventricular cardiomyocytes.
26884465 HuR blocks miR-675 processing from H19 and prevents H19-induced intestinal barrier barrier dysfunction.
26874904 These results define a novel mechanism by which PKM2 regulates glioma cell growth, and also define a novel set of potential therapeutic targets along the PKM2-HuR-p27 pathway
26866372 Mesenchymal stromal cells inhibit Human antigen R (HuR) trascription, an enhancer of RENmRNA stability by IL10 release
26819413 miR-424 interacts with long non-coding RNA OIP5-AS1 and competes with HuR for binding to OIP5-AS1.
26764246 Cytoplasmic accumulation of ELAVL1 was identified as a predictor of adverse clinical behavior of prostate cancer.
26731986 Down regulation of miR-31 contributed to the malignant progression of papillary thyroid carcinoma cells by targeting HuR
26692264 HuR protein mediates resistance to carboplatin in ovarian cancer cells.
More...

AA Sequence

MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVT      1 - 70
AKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVD     71 - 140
QTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGP    141 - 210
VHHQAQRFRFSPMGVDHMSGLSGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFN    211 - 280
TNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK                            281 - 326
//

Text Mined References (314)

PMID Year Title
27401462 2016 Posttranscriptional regulation of 14-3-3? by RNA-binding protein HuR modulating intestinal epithelial restitution after wounding.
27215092 2016 MiR-31 Functions as a Tumor Suppressor in Lung Adenocarcinoma Mainly by Targeting HuR.
27089893 2016 Post-transcriptional regulation of Wnt co-receptor LRP6 and RNA-binding protein HuR by miR-29b in intestinal epithelial cells.
26898797 2016 MicroRNA-9 inhibits hyperglycemia-induced pyroptosis in human ventricular cardiomyocytes by targeting ELAVL1.
26884465 2016 H19 Long Noncoding RNA Regulates Intestinal Epithelial Barrier Function via MicroRNA 675 by Interacting with RNA-Binding Protein HuR.
26874904 2016 PKM2 uses control of HuR localization to regulate p27 and cell cycle progression in human glioblastoma cells.
26866372 2016 Mesenchymal Stromal Cells Prevent Renal Fibrosis in a Rat Model of Unilateral Ureteral Obstruction by Suppressing the Renin-Angiotensin System via HuR.
26819413 2016 LncRNA OIP5-AS1/cyrano sponges RNA-binding protein HuR.
26764246 2016 Cytoplasmic accumulation of ELAVL1 is an independent predictor of biochemical recurrence associated with genomic instability in prostate cancer.
26731986 2015 miR-31 Reduces Cell Growth of Papillary Thyroid Carcinoma by RNA-Binding Protein HuR.
More...