Property Summary

NCBI Gene PubMed Count 32
PubMed Score 41.49
PubTator Score 44.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 6.54117604158078E-24
psoriasis 6685 1.69602775553494E-16
Breast cancer 3099 3.08169008679544E-16
atypical teratoid / rhabdoid tumor 4369 2.14115362386437E-8
posterior fossa group B ependymoma 1530 3.86959201811736E-8
pediatric high grade glioma 2712 2.47402349757761E-6
primitive neuroectodermal tumor 3031 3.13000861129155E-6
sonic hedgehog group medulloblastoma 1482 3.3004982369131E-6
acute quadriplegic myopathy 1157 1.08203998902319E-5
glioblastoma 5572 7.69554910297988E-5
lung cancer 4473 2.66721703321542E-4
pancreatic cancer 2300 5.76294412560248E-4
dermatomyositis 967 6.11109930345669E-4
tuberculosis and treatment for 6 months 686 6.67414731377937E-4
medulloblastoma, large-cell 6234 7.09665018557668E-4
primary pancreatic ductal adenocarcinoma 1271 0.0014151744741932
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00530114556631093
pancreatic carcinoma 567 0.00710989141064846
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00945331685887356
urothelial carcinoma 318 0.0127534244892987
cystic fibrosis and chronic rhinosinusitis 213 0.0149854796456834
invasive ductal carcinoma 2950 0.0487787086618039
Disease Target Count Z-score Confidence
Vascular disease 281 0.0 1.0

Expression

Synonym

Accession Q15714 B3KRL7 B9EGI0 O00666 Q6AHX5 Q6IBU1 Q8NCN1 Q96JS5
Symbols Ptg-2
TSC22
TGFB1I4

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Pig OMA EggNOG
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG
Zebrafish OMA Inparanoid

Gene RIF (16)

PMID Text
22870275 TSC-22 acts as a tumor suppressor by safeguarding p53 from poly-ubiquitination mediated-degradation.
21881999 we report that induced Tsc-22 leads to enhancement of TGF-beta-dependent signaling and enhancement is blocked by expression of a dominant-negative Tsc-22 mutant
21448135 Differential regulation of antagonistic TSC22D1 variants is required for the establishment of oncogene-induced cellular senescence.
20802130 Results support role of TSC22D1 as an enhancer of CNP transcription and suggest that TGF-beta-induced upregulation of CNP expression in smooth muscle may be mediated in part by increased transcription of TSC22D1.
20149264 Long form of TSC22DF is evolutionarily conserved and has growth-regulating potential.
18325344 interaction between fortilin and TSC-22 prevents apoptosis via the destabilization of TSC-22 in ovarian carcinoma cells
18288391 Expression of TSC-22 was frequently observed in the tumor cells with differentiated-phenotypes, although rarely in the cells with growing potentials.
17690703 TSC-22 is a potential tumor suppressor that is upregulated by Flt3-D835V but not Flt3-ITD
17622752 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16106424 expression of TSC-22 in prostate is restricted to basal layer; maybe useful marker for differentation between normal and malignant acinar epithelium of prostate
More...

AA Sequence

MHQPPESTAAAAAAADISARKMAHPAMFPRRGSGSGSASALNAAGTGVGSNATSSEDFPPPSLLQPPPPA      1 - 70
ASSTSGPQPPPPQSLNLLSQAQLQAQPLAPGGTQMKKKSGFQITSVTPAQISASISSNNSIAEDTESYDD     71 - 140
LDESHTEDLSSSEILDVSLSRATDLGEPERSSSEETLNNFQEAETPGAVSPNQPHLPQPHLPHLPQQNVV    141 - 210
INGNAHPHHLHHHHQIHHGHHLQHGHHHPSHVAVASASITGGPPSSPVSRKLSTTGSSDSITPVAPTSAV    211 - 280
SSSGSPASVMTNMRAPSTTGGIGINSVTGTSTVNNVNITAVGSFNPNVTSSMLGNVNISTSNIPSAAGVS    281 - 350
VGPGVTSGVNVNILSGMGNGTISSSAAVSSVPNAAAGMTGGSVSSQQQQPTVNTSRFRVVKLDSSSEPFK    351 - 420
KGRWTCTEFYEKENAVPATEGVLINKVVETVKQNPIEVTSERESTSGSSVSSSVSTLSHYTESVGSGEMG    421 - 490
APTVVVQQQQQQQQQQQQQPALQGVTLQQMDFGSTGPQSIPAVSIPQSISQSQISQVQLQSQELSYQQKQ    491 - 560
GLQPVPLQATMSAATGIQPSPVNVVGVTSALGQQPSISSLAQPQLPYSQAAPPVQTPLPGAPPPQQLQYG    561 - 630
QQQPMVSTQMAPGHVKSVTQNPASEYVQQQPILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTA    631 - 700
VPAQPAGASVQPVGQAPAAVSAVPTGSQIANIGQQANIPTAVQQPSTQVPPSVIQQGAPPSSQVVPPAQT    701 - 770
GIIHQGVQTSAPSLPQQLVIASQSSLLTVPPQPQGVEPVAQGIVSQQLPAVSSLPSASSISVTSQVSSTG    771 - 840
PSGMPSAPTNLVPPQNIAQTPATQNGNLVQSVSQPPLIATNTNLPLAQQIPLSSTQFSAQSLAQAIGSQI    841 - 910
EDARRAAEPSLVGLPQTISGDSGGMSAVSDGSSSSLAASASLFPLKVLPLTTPLVDGEDESSSGASVVAI    911 - 980
DNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPA    981 - 1050
TTQPQGTTQPPAQPASQGSGPTA                                                  1051 - 1073
//

Text Mined References (36)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22870275 2012 Crucial role of TSC-22 in preventing the proteasomal degradation of p53 in cervical cancer.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
21881999 2012 Regulation of TGF-? signaling by PKC depends on Tsc-22 inducibility.
21448135 2011 Antagonistic TSC22D1 variants control BRAF(E600)-induced senescence.
21269460 2011 Initial characterization of the human central proteome.
20802130 2010 Transforming growth factor-beta1 regulation of C-type natriuretic peptide expression in human vascular smooth muscle cells: dependence on TSC22D1.
20149264 2010 Madm (Mlf1 adapter molecule) cooperates with Bunched A to promote growth in Drosophila.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18355271 2008 A TSC22-like motif defines a novel antiapoptotic protein family.
More...