Property Summary

NCBI Gene PubMed Count 32
Grant Count 5
R01 Count 5
Funding $588,671.67
PubMed Score 41.49
PubTator Score 44.01

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
22870275 TSC-22 acts as a tumor suppressor by safeguarding p53 from poly-ubiquitination mediated-degradation.
21881999 we report that induced Tsc-22 leads to enhancement of TGF-beta-dependent signaling and enhancement is blocked by expression of a dominant-negative Tsc-22 mutant
21448135 Differential regulation of antagonistic TSC22D1 variants is required for the establishment of oncogene-induced cellular senescence.
20802130 Results support role of TSC22D1 as an enhancer of CNP transcription and suggest that TGF-beta-induced upregulation of CNP expression in smooth muscle may be mediated in part by increased transcription of TSC22D1.
20149264 Long form of TSC22DF is evolutionarily conserved and has growth-regulating potential.
18325344 interaction between fortilin and TSC-22 prevents apoptosis via the destabilization of TSC-22 in ovarian carcinoma cells
18288391 Expression of TSC-22 was frequently observed in the tumor cells with differentiated-phenotypes, although rarely in the cells with growing potentials.
17690703 TSC-22 is a potential tumor suppressor that is upregulated by Flt3-D835V but not Flt3-ITD
17622752 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16106424 expression of TSC-22 in prostate is restricted to basal layer; maybe useful marker for differentation between normal and malignant acinar epithelium of prostate
More...

AA Sequence

MHQPPESTAAAAAAADISARKMAHPAMFPRRGSGSGSASALNAAGTGVGSNATSSEDFPPPSLLQPPPPA      1 - 70
ASSTSGPQPPPPQSLNLLSQAQLQAQPLAPGGTQMKKKSGFQITSVTPAQISASISSNNSIAEDTESYDD     71 - 140
LDESHTEDLSSSEILDVSLSRATDLGEPERSSSEETLNNFQEAETPGAVSPNQPHLPQPHLPHLPQQNVV    141 - 210
INGNAHPHHLHHHHQIHHGHHLQHGHHHPSHVAVASASITGGPPSSPVSRKLSTTGSSDSITPVAPTSAV    211 - 280
SSSGSPASVMTNMRAPSTTGGIGINSVTGTSTVNNVNITAVGSFNPNVTSSMLGNVNISTSNIPSAAGVS    281 - 350
VGPGVTSGVNVNILSGMGNGTISSSAAVSSVPNAAAGMTGGSVSSQQQQPTVNTSRFRVVKLDSSSEPFK    351 - 420
KGRWTCTEFYEKENAVPATEGVLINKVVETVKQNPIEVTSERESTSGSSVSSSVSTLSHYTESVGSGEMG    421 - 490
APTVVVQQQQQQQQQQQQQPALQGVTLQQMDFGSTGPQSIPAVSIPQSISQSQISQVQLQSQELSYQQKQ    491 - 560
GLQPVPLQATMSAATGIQPSPVNVVGVTSALGQQPSISSLAQPQLPYSQAAPPVQTPLPGAPPPQQLQYG    561 - 630
QQQPMVSTQMAPGHVKSVTQNPASEYVQQQPILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTA    631 - 700
VPAQPAGASVQPVGQAPAAVSAVPTGSQIANIGQQANIPTAVQQPSTQVPPSVIQQGAPPSSQVVPPAQT    701 - 770
GIIHQGVQTSAPSLPQQLVIASQSSLLTVPPQPQGVEPVAQGIVSQQLPAVSSLPSASSISVTSQVSSTG    771 - 840
PSGMPSAPTNLVPPQNIAQTPATQNGNLVQSVSQPPLIATNTNLPLAQQIPLSSTQFSAQSLAQAIGSQI    841 - 910
EDARRAAEPSLVGLPQTISGDSGGMSAVSDGSSSSLAASASLFPLKVLPLTTPLVDGEDESSSGASVVAI    911 - 980
DNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPA    981 - 1050
TTQPQGTTQPPAQPASQGSGPTA                                                  1051 - 1073
//

Text Mined References (36)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22870275 2012 Crucial role of TSC-22 in preventing the proteasomal degradation of p53 in cervical cancer.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
21881999 2012 Regulation of TGF-? signaling by PKC depends on Tsc-22 inducibility.
21448135 2011 Antagonistic TSC22D1 variants control BRAF(E600)-induced senescence.
21269460 2011 Initial characterization of the human central proteome.
20802130 2010 Transforming growth factor-beta1 regulation of C-type natriuretic peptide expression in human vascular smooth muscle cells: dependence on TSC22D1.
20149264 2010 Madm (Mlf1 adapter molecule) cooperates with Bunched A to promote growth in Drosophila.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18355271 2008 A TSC22-like motif defines a novel antiapoptotic protein family.
More...