Property Summary

NCBI Gene PubMed Count 55
Grant Count 60
R01 Count 38
Funding $9,975,839.83
PubMed Score 49.90
PubTator Score 35.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
interstitial lung disease 1.100 0.013
astrocytic glioma -2.300 0.004
ependymoma -4.100 0.000
oligodendroglioma -2.300 0.000
cutaneous lupus erythematosus -2.600 0.000
psoriasis -2.600 0.000
glioblastoma -4.400 0.000
medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -4.600 0.000
medulloblastoma, large-cell -4.800 0.000
primitive neuroectodermal tumor -3.100 0.000
adrenocortical carcinoma -1.908 0.001
lung cancer 1.500 0.005
interstitial cystitis -1.300 0.001
pediatric high grade glioma -4.000 0.000
pilocytic astrocytoma -3.300 0.000
aldosterone-producing adenoma -1.132 0.046
subependymal giant cell astrocytoma -2.503 0.016
lung carcinoma 2.800 0.000

Synonym

Accession Q15700 B7WNY8 F8W9V6 Q59G57 Q5H9Q4 Q68CQ8 Q6ZTA8
Symbols PSD93
PSD-93
PPP1R58
chapsyn-110

Gene

PDB

2BYG   2HE2  

Gene RIF (13)

PMID Text
26460480 DLG2 - novel candidate genes validated in a large case-control sample of schizophrenia.
23519667 The PDZ1 domain of PSD-93 might accept peptides with larger residues at the C-terminus than that of PSD-95, for example the GluD2 C-terminal Ile versus the Val found at the C-terminus of NMDA receptors.
23201973 This study showed that DLG2 is related the complex learning.
20398908 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20054121 Comparison of the structures of the binding cleft of PSD-93 PDZ1 with the previously reported structures of PSD-93 PDZ2 and PDZ3 as well as of the closely related human PSD-95 PDZ1 shows that they are very similar in terms of amino-acid composition
19931931 Variation at the DLG2 locus contributes to maintenance of glucose homeostasis through regulation of insulin sensitivity and beta-cell function.
19931931 Observational study of gene-disease association. (HuGE Navigator)
19736351 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQIENVHGYVLQSHISPLKAS      1 - 70
PAPIIVNTDTLDTIPYVNGTEIEYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAE     71 - 140
DGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKGLGFSIAGG    141 - 210
VGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSEVVYLKVGKPT    211 - 280
TIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYST    281 - 350
VNKLCDKPASPRHYSPVECDKSFLLSAPYSHYHLGLLPDSEMTSHSQHSTATRQPSMTLQRAVSLEGEPR    351 - 420
KVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGA    421 - 490
GQTVTIIAQYQPEDYARFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGL    491 - 560
SFKYGDILHVINASDDEWWQARRVMLEGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGSFND    561 - 630
KRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISE    631 - 700
FPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGK    701 - 770
HCILDVSGNAIKRLQVAQLYPIAIFIKPRSLEPLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQG    771 - 840
DTLEDIYNQCKLVIEEQSGPFIWIPSKEKL                                            841 - 870
//

Text Mined References (61)

PMID Year Title
26460480 2015 Expression analysis in a rat psychosis model identifies novel candidate genes validated in a large case-control sample of schizophrenia.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
25008200 2014 Genome wide association scan for chronic periodontitis implicates novel locus.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23519667 2013 Interaction partners of PSD-93 studied by X-ray crystallography and fluorescence polarization spectroscopy.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23201973 2013 Synaptic scaffold evolution generated components of vertebrate cognitive complexity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22544364 2012 A genome-wide association study identifies susceptibility loci for Wilms tumor.
More...