Property Summary

NCBI Gene PubMed Count 56
PubMed Score 53.57
PubTator Score 35.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.908 5.1e-04
adult high grade glioma -2.100 1.5e-04
aldosterone-producing adenoma -1.132 4.6e-02
astrocytic glioma -1.700 2.0e-03
Astrocytoma, Pilocytic -2.300 4.5e-08
atypical teratoid / rhabdoid tumor -2.100 1.5e-08
cutaneous lupus erythematosus -2.600 3.4e-04
ependymoma -2.400 4.9e-04
glioblastoma -2.200 2.3e-11
group 3 medulloblastoma -2.300 1.2e-03
interstitial cystitis -1.200 8.2e-03
interstitial lung disease 1.100 1.3e-02
lung cancer 1.100 5.8e-03
lung carcinoma 2.800 5.4e-33
medulloblastoma, large-cell -2.200 2.1e-05
oligodendroglioma -1.700 1.8e-03
primitive neuroectodermal tumor -1.700 1.1e-03
psoriasis -2.600 1.3e-04
subependymal giant cell astrocytoma -2.503 1.6e-02

Gene RIF (14)

AA Sequence

MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQIENVHGYVLQSHISPLKAS      1 - 70
PAPIIVNTDTLDTIPYVNGTEIEYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAE     71 - 140
DGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKGLGFSIAGG    141 - 210
VGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSEVVYLKVGKPT    211 - 280
TIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYST    281 - 350
VNKLCDKPASPRHYSPVECDKSFLLSAPYSHYHLGLLPDSEMTSHSQHSTATRQPSMTLQRAVSLEGEPR    351 - 420
KVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGA    421 - 490
GQTVTIIAQYQPEDYARFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGL    491 - 560
SFKYGDILHVINASDDEWWQARRVMLEGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGSFND    561 - 630
KRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISE    631 - 700
FPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGK    701 - 770
HCILDVSGNAIKRLQVAQLYPIAIFIKPRSLEPLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQG    771 - 840
DTLEDIYNQCKLVIEEQSGPFIWIPSKEKL                                            841 - 870
//

Text Mined References (62)

PMID Year Title