Property Summary

NCBI Gene PubMed Count 19
PubMed Score 33.68
PubTator Score 30.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 9.8e-03
cystic fibrosis 2.613 6.5e-07
group 3 medulloblastoma 1.600 3.3e-05
posterior fossa group A ependymoma 1.200 2.7e-05

Gene RIF (9)

AA Sequence

MEFLSEKFALKSPPSKNSDFYMGAGGPLEHVMETLDNESFYSKASAGKCVQAFGPLPRAEHHVRLERTSP      1 - 70
CQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELGDKCDSNVSSSKKRRHRTTFT     71 - 140
SLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDIS    141 - 210
VLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNF    211 - 280
FTDSLLTGATNGHAFETKPEFERRSSSIAVLRMKAKEHTANISWAM                            281 - 326
//

Text Mined References (20)

PMID Year Title