Property Summary

NCBI Gene PubMed Count 18
Grant Count 6
R01 Count 6
Funding $309,327.8
PubMed Score 27.48
PubTator Score 30.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 0.010
cystic fibrosis 2.613 0.000
group 3 medulloblastoma 1.600 0.000
posterior fossa group B ependymoma 1.300 0.000

Gene RIF (8)

PMID Text
27053613 Knockdown of the CART1 gene significantly inhibited cell invasion and proliferation and induce cell cycle arrest in S phase.
26722397 we identify critical roles of ALX1 in lung cancer development and progression
25736924 we found that depletion of ALX1 caused a dramatic cell cycle arrest, followed by massive apoptotic cell death, and eventually resulted in a significant decrease in migration and invasion of the osteosarcoma cell line studied.
24081945 hypermethylation of HIST1H4F, PCDHGB6, NPBWR1, ALX1, and HOXA9 was significantly associated with shorter survival in stage 1 Non-small-cell lung cancer
23288509 ALX1 upregulated expression of the key EMT regulator Snail (SNAI1) and that it mediated EMT activation and cell invasion by ALX1.
20932315 Observational study of gene-disease association. (HuGE Navigator)
20451171 Disruption of CART1 (ALX1) causes extreme microphthalmia and severe facial clefting.
18976975 Knockdown of ALX homeobox 1 (ALX1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MEFLSEKFALKSPPSKNSDFYMGAGGPLEHVMETLDNESFYSKASAGKCVQAFGPLPRAEHHVRLERTSP      1 - 70
CQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELGDKCDSNVSSSKKRRHRTTFT     71 - 140
SLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDIS    141 - 210
VLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNF    211 - 280
FTDSLLTGATNGHAFETKPEFERRSSSIAVLRMKAKEHTANISWAM                            281 - 326
//

Text Mined References (19)

PMID Year Title
27053613 2016 [Knockdown of CART1 induces S phase arrest and inhibits invasion and migration of MDA-MB-231 breast cancer cells].
26722397 2015 ALX1 promotes migration and invasion of lung cancer cells through increasing snail expression.
25736924 2015 Depletion of ALX1 causes inhibition of migration and induction of apoptosis in human osteosarcoma.
24081945 2013 A prognostic DNA methylation signature for stage I non-small-cell lung cancer.
23288509 2013 ALX1 induces snail expression to promote epithelial-to-mesenchymal transition and invasion of ovarian cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20932315 2010 Genes encoding critical transcriptional activators for murine neural tube development and human spina bifida: a case-control study.
20451171 2010 Disruption of ALX1 causes extreme microphthalmia and severe facial clefting: expanding the spectrum of autosomal-recessive ALX-related frontonasal dysplasia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...