Property Summary

NCBI Gene PubMed Count 10
PubMed Score 28.67
PubTator Score 8.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.4020080110636E-5
lung cancer 4473 4.29135045592725E-5
astrocytic glioma 2241 0.0376138150355195

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.100 0.038
osteosarcoma -1.435 0.000
lung cancer 2.200 0.000

Synonym

Accession Q15697 Q53Y68 Q9BQ34
Symbols ZSCAN8

Gene

PDB

1Y7Q  

  Ortholog (6)

Pathway (1)

Gene RIF (1)

PMID Text
11741982 Both size exclusion chromatography and equilibrium sedimentation analysis demonstrate that the ZNF174 SCAN domain forms a homodimer

AA Sequence

MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQL      1 - 70
CRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQ     71 - 140
GQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTEA    141 - 210
PRMRSDNKENPQQEGAKGAKPCAVSAGRSKGNGLQNPEPRGANMSEPRLSRRQVSSPNAQKPFAHYQRHC    211 - 280
RVEYISSPLKSHPLRELKKSKGGKRSLSNRLQHLGHQPTRSAKKPYKCDDCGKSFTWNSELKRHKRVHTG    281 - 350
ERPYTCGECGNCFGRQSTLKLHQRIHTGEKPYQCGQCGKSFRQSSNLHQHHRLHHGD                 351 - 407
//

Text Mined References (10)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15629724 2005 Mammalian SCAN domain dimer is a domain-swapped homolog of the HIV capsid C-terminal domain.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10567577 1999 The zinc finger-associated SCAN box is a conserved oligomerization domain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7673192 1995 Isolation and characterization of a novel zinc-finger protein with transcription repressor activity.