Property Summary

NCBI Gene PubMed Count 10
Grant Count 4
R01 Count 4
Funding $232,260
PubMed Score 28.67
PubTator Score 8.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.100 0.038
osteosarcoma -1.435 0.000
lung cancer 2.200 0.000

Gene RIF (1)

PMID Text
11741982 Both size exclusion chromatography and equilibrium sedimentation analysis demonstrate that the ZNF174 SCAN domain forms a homodimer

AA Sequence

MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQL      1 - 70
CRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQ     71 - 140
GQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTEA    141 - 210
PRMRSDNKENPQQEGAKGAKPCAVSAGRSKGNGLQNPEPRGANMSEPRLSRRQVSSPNAQKPFAHYQRHC    211 - 280
RVEYISSPLKSHPLRELKKSKGGKRSLSNRLQHLGHQPTRSAKKPYKCDDCGKSFTWNSELKRHKRVHTG    281 - 350
ERPYTCGECGNCFGRQSTLKLHQRIHTGEKPYQCGQCGKSFRQSSNLHQHHRLHHGD                 351 - 407
//

Text Mined References (10)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15629724 2005 Mammalian SCAN domain dimer is a domain-swapped homolog of the HIV capsid C-terminal domain.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10567577 1999 The zinc finger-associated SCAN box is a conserved oligomerization domain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7673192 1995 Isolation and characterization of a novel zinc-finger protein with transcription repressor activity.