Property Summary

NCBI Gene PubMed Count 11
PubMed Score 32.71
PubTator Score 8.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.4e-05
lung cancer 4740 4.3e-05
astrocytic glioma 2597 3.8e-02

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.100 3.8e-02
lung cancer 2.200 4.3e-05
osteosarcoma -1.435 1.4e-05

Gene RIF (1)

AA Sequence

MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQL      1 - 70
CRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQ     71 - 140
GQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTEA    141 - 210
PRMRSDNKENPQQEGAKGAKPCAVSAGRSKGNGLQNPEPRGANMSEPRLSRRQVSSPNAQKPFAHYQRHC    211 - 280
RVEYISSPLKSHPLRELKKSKGGKRSLSNRLQHLGHQPTRSAKKPYKCDDCGKSFTWNSELKRHKRVHTG    281 - 350
ERPYTCGECGNCFGRQSTLKLHQRIHTGEKPYQCGQCGKSFRQSSNLHQHHRLHHGD                 351 - 407
//

Text Mined References (12)

PMID Year Title