Property Summary

NCBI Gene PubMed Count 32
Grant Count 3
Funding $103,596.4
PubMed Score 40.87
PubTator Score 44.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
osteosarcoma 3.434 0.000
atypical teratoid / rhabdoid tumor 1.200 0.002
glioblastoma 1.100 0.005
medulloblastoma, large-cell 1.500 0.011
pancreatic ductal adenocarcinoma liver m... 1.382 0.030
intraductal papillary-mucinous adenoma (... 1.300 0.000
nasopharyngeal carcinoma 1.100 0.007
lung carcinoma -1.400 0.000
breast carcinoma -1.200 0.000
spina bifida -1.623 0.017
Pick disease 1.100 0.000
Breast cancer -2.000 0.000
invasive ductal carcinoma -2.000 0.013
ulcerative colitis 1.200 0.000
ovarian cancer -1.900 0.000
pituitary cancer -3.000 0.000

Synonym

Accession Q15678 Q5VSI0
Symbols PEZ
PTP36

Gene

PDB

2BZL  

Gene RIF (14)

PMID Text
25814387 PTPN14, a Pez mammalian homolog, is degraded by overexpressed Su(dx) or Su(dx) homologue WWP1 in mammalian cells.
25803229 PTPN14 and PTEN were identified as direct and functional targets of miR-21.
25681440 Findings indicate a pathway involving protein-tyrosine phosphatase D2 PTPD2 (PTPN14) and the lipid second messenger phosphatidic acid that promotes ERBB2 receptor function.
25023289 results indicate a potential regulatory role of PTPN14 in the Hippo pathway and demonstrate another layer of regulation in the YAP oncogenic function
23613971 Data demonstrate that PTPN14 downregulation can phenocopy YAP activation in mammary epithelial cells and synergize with YAP to induce oncogenic transformation.
22948661 that PTPN14 acts to suppress cell proliferation by promoting cell density-dependent cytoplasmic translocation of YAP1
22710723 Data show that p130 Crk-associated substrate is a direct substrate of PTPN14 and that PTPN14 specifically regulates p130Cas phosphorylation at tyrosine residue 128 in colorectal cancer cells.
22689061 YAP forms a protein complex with PTPN14 through the WW domains of YAP and the PPXY motifs of PTPN14.
22525271 YAP is a direct substrate of PTPN14. Results indicate a potential regulatory role of PTPN14 on YAP and demonstrate a novel mechanism in YAP regulation.
22233626 PTPN14 has a role in angiogenesis and/or arteriovenous fate, acting via EphrinB2 and ACVRL1/activin receptor-like kinase 1
More...

AA Sequence

MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETHYFGLWFLSKS      1 - 70
QQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYLQVKKDVLEGRLRCTLDQVIR     71 - 140
LAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLEELTQKVAQEHKAHSGILPAEAELMYINEVE    141 - 210
RLDGFGQEIFPVKDNHGNCVHLGIFFMGIFVRNRIGRQAVIYRWNDMGNITHNKSTILVELINKEETALF    211 - 280
HTDDIENAKYISRLFATRHKFYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPVHVQCGEHYSE    281 - 350
THTSQDSIFHGNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCSQSFIQASPVSSNLSIPGSDI    351 - 420
MRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGILHTDSQSQSLRNLNIINTHAYNQPEDLVYSQPEM    421 - 490
RERHPYTVPYGPQGVYSNKLVSPSDQRNPKNNVVPSKPGASAISHTVSTPELANMQLQGSHNYSTAHMLK    491 - 560
NYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTRKVQLSVKTFQEDSSPVVHQSLQEVSEPLTA    561 - 630
TKHHGTVNKRHSLEVMNSMVRGMEAMTLKSLHLPMARRNTLREQGPPEEGSGSHEVPQLPQYHHKKTFSD    631 - 700
ATMLIHSSESEEEEEEAPESVPQIPMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQAS    701 - 770
LPPAMARARVLRHGPAKAISMSRTDPPAVNGASLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSI    771 - 840
IEREMMIRNLEKQKMAGLEAQKRPLMLAALNGLSVARVSGREENRVDATRVPMDERFRTLKKKLEEGMVF    841 - 910
TEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNTGYINASHIKVVVGGAEWHYI    911 - 980
ATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSHRYWPKLGSKHSSATYGKFKVTTKFRTDSVC    981 - 1050
YATTGLKVKHLLSGQERTVWHLQYTDWPDHGCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVH   1051 - 1120
CSAGVGRTGVLILSELMIYCLEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI      1121 - 1187
//

Text Mined References (41)

PMID Year Title
25814387 2015 Suppressor of Deltex mediates Pez degradation and modulates Drosophila midgut homeostasis.
25803229 2015 MiR-21 promotes intrahepatic cholangiocarcinoma proliferation and growth in vitro and in vivo by targeting PTPN14 and PTEN.
25681440 2015 A novel phosphatidic acid-protein-tyrosine phosphatase D2 axis is essential for ERBB2 signaling in mammary epithelial cells.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25283809 2014 Ligand binding to WW tandem domains of YAP2 transcriptional regulator is under negative cooperativity.
25023289 2014 PTPN14 forms a complex with Kibra and LATS1 proteins and negatively regulates the YAP oncogenic function.
24722205 2014 A genome-wide association study on thyroid function and anti-thyroid peroxidase antibodies in Koreans.
24386095 2013 A genome wide association study identifies common variants associated with lipid levels in the Chinese population.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
More...