Property Summary

NCBI Gene PubMed Count 37
PubMed Score 43.19
PubTator Score 44.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.9e-03
Breast cancer -2.000 6.6e-14
breast carcinoma -1.200 7.2e-33
glioblastoma 1.100 4.7e-03
intraductal papillary-mucinous adenoma (... 1.300 4.2e-04
invasive ductal carcinoma -2.000 1.3e-02
lung carcinoma -1.400 1.9e-15
medulloblastoma, large-cell 1.500 1.1e-02
nasopharyngeal carcinoma 1.100 6.9e-03
osteosarcoma 1.929 4.2e-05
ovarian cancer -1.900 1.2e-07
pancreatic ductal adenocarcinoma liver m... 1.382 3.0e-02
Pick disease 1.100 1.8e-04
pituitary cancer -3.000 3.4e-11
spina bifida -1.384 1.9e-02
ulcerative colitis 1.200 3.8e-04

Protein-protein Interaction (5)

Gene RIF (18)

AA Sequence

MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETHYFGLWFLSKS      1 - 70
QQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYLQVKKDVLEGRLRCTLDQVIR     71 - 140
LAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLEELTQKVAQEHKAHSGILPAEAELMYINEVE    141 - 210
RLDGFGQEIFPVKDNHGNCVHLGIFFMGIFVRNRIGRQAVIYRWNDMGNITHNKSTILVELINKEETALF    211 - 280
HTDDIENAKYISRLFATRHKFYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPVHVQCGEHYSE    281 - 350
THTSQDSIFHGNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCSQSFIQASPVSSNLSIPGSDI    351 - 420
MRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGILHTDSQSQSLRNLNIINTHAYNQPEDLVYSQPEM    421 - 490
RERHPYTVPYGPQGVYSNKLVSPSDQRNPKNNVVPSKPGASAISHTVSTPELANMQLQGSHNYSTAHMLK    491 - 560
NYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTRKVQLSVKTFQEDSSPVVHQSLQEVSEPLTA    561 - 630
TKHHGTVNKRHSLEVMNSMVRGMEAMTLKSLHLPMARRNTLREQGPPEEGSGSHEVPQLPQYHHKKTFSD    631 - 700
ATMLIHSSESEEEEEEAPESVPQIPMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQAS    701 - 770
LPPAMARARVLRHGPAKAISMSRTDPPAVNGASLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSI    771 - 840
IEREMMIRNLEKQKMAGLEAQKRPLMLAALNGLSVARVSGREENRVDATRVPMDERFRTLKKKLEEGMVF    841 - 910
TEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNTGYINASHIKVVVGGAEWHYI    911 - 980
ATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSHRYWPKLGSKHSSATYGKFKVTTKFRTDSVC    981 - 1050
YATTGLKVKHLLSGQERTVWHLQYTDWPDHGCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVH   1051 - 1120
CSAGVGRTGVLILSELMIYCLEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI      1121 - 1187
//

Text Mined References (46)

PMID Year Title