Property Summary

NCBI Gene PubMed Count 393
Grant Count 345
R01 Count 219
Funding $71,657,872.01
PubMed Score 7558.35
PubTator Score 670.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Synonym

Accession Q15672 A4D128 Q92487 Q99804
Symbols CRS
CSO
SCS
ACS3
CRS1
BPES2
BPES3
TWIST
bHLHa38

Gene

PDB

2MJV  

 GO Component (1)

Gene RIF (369)

PMID Text
26940738 expression of ZEB1 and TWIST1, which are master regulators of tumor metastasis. Our study first indicates that miR-1271 functions as a suppressor in regulating of pancreatic cancer EMT by targeting ZEB1 and TWIST1.
26910679 TWIST1 gene mutation maybe an underlying factor in the development of craniosynostosis.
26905590 findings not only pinpoint that Twist1 mediates the modulatory function of PAQR3 on EMT and metastasis but also suggest that targeting Twist1 is a promising strategy to control metastasis of tumors with downregulation of PAQR3
26832848 Study found that upregulated Twist1 increased Bmi1 expression in acute myeloid leukemia (AML) and endued leukemic cells a higher proliferative potential and increased resistance to apoptosis. In primary AML samples, there was strong positive correlation between the expression levels of Twist1 and Bmi1.
26782761 Twist and P-gp are expressed correlatively in human colorectal cancer specimens
26762267 Findings suggest that miR-548c directly downregulates Twist, and provide a novel mechanism for Twist upregulation in both endometrial and ovarian cancers.
26718342 Our results identified TWIST1 as a transcription factor that regulates C3 expression during pathologic and physiologic epithelial-mesenchymal transition
26718114 findings demonstrate that Twist-1, which maintains BMSC at an immature state, endows them with an increased capacity for supporting hematopoiesis via direct activation of CXCL12 gene expression.
26693891 Twist-ITGB1-FAK/ILK pathway and their downstream signaling network dictate the Twist-induced EMT process in human mammary epithelial cells and breast cancer cells
26656856 Data suggest that basic helix-loop-helix transcription factor TWIST might play critical roles in cancer progression and act as a prognostic factor for head and neck carcinoma (HNC) patients.
More...

AA Sequence

MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPA      1 - 70
QGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPS     71 - 140
DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH            141 - 202
//

Text Mined References (393)

PMID Year Title
26940738 2016 miR-1271 inhibits migration, invasion and epithelial-mesenchymal transition by targeting ZEB1 and TWIST1 in pancreatic cancer cells.
26910679 2016 Mutation Screening of Candidate Genes in Patients with Nonsyndromic Sagittal Craniosynostosis.
26905590 2016 PAQR3 enhances Twist1 degradation to suppress epithelial-mesenchymal transition and metastasis of gastric cancer cells.
26832848 2015 Favorable clinical outcome and unique characteristics in association with Twist1 overexpression in de novo acute myeloid leukemia.
26782761 2016 Twist mediates an aggressive phenotype in human colorectal cancer cells.
26762267 2016 MiR-548c impairs migration and invasion of endometrial and ovarian cancer cells via downregulation of Twist.
26718342 2016 Complement Component 3 Is Regulated by TWIST1 and Mediates Epithelial-Mesenchymal Transition.
26718114 2016 Twist-1 Enhances Bone Marrow Mesenchymal Stromal Cell Support of Hematopoiesis by Modulating CXCL12 Expression.
26693891 2016 Twist induces epithelial-mesenchymal transition and cell motility in breast cancer via ITGB1-FAK/ILK signaling axis and its associated downstream network.
26656856 2015 Is overexpression of TWIST, a transcriptional factor, a prognostic biomarker of head and neck carcinoma? Evidence from fifteen studies.
More...