Property Summary

NCBI Gene PubMed Count 42
PubMed Score 87.52
PubTator Score 324.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.200 7.4e-04
atypical teratoid / rhabdoid tumor 1.600 1.8e-03
breast carcinoma 1.300 1.1e-03
cutaneous lupus erythematosus 2.300 2.3e-03
ductal carcinoma in situ 1.700 1.3e-02
fibroadenoma 1.100 2.0e-02
glioblastoma 1.300 1.7e-05
group 4 medulloblastoma 1.400 1.5e-03
interstitial cystitis 2.200 2.4e-03
invasive ductal carcinoma 1.900 2.2e-02
lung cancer -1.700 4.9e-03
lung carcinoma -1.100 1.8e-10
osteosarcoma -1.839 1.1e-03
ovarian cancer 1.100 2.6e-07
primary Sjogren syndrome 1.700 3.0e-04
psoriasis 1.500 1.6e-03
ulcerative colitis 2.300 1.8e-05

Gene RIF (19)

AA Sequence

MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRP      1 - 70
LSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQREMGPHRASCVNAMEGKKLA     71 - 140
QDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF                       141 - 191
//

Text Mined References (42)

PMID Year Title