Property Summary

NCBI Gene PubMed Count 41
PubMed Score 85.91
PubTator Score 324.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.77613940528573E-10
ovarian cancer 8492 2.58699454706012E-7
glioblastoma 5572 1.6982047160726E-5
ulcerative colitis 2087 1.7744784026091E-5
lung cancer 4473 1.26986464345246E-4
primary Sjogren syndrome 789 3.0291640808968E-4
adult high grade glioma 2148 7.39421468606272E-4
osteosarcoma 7933 0.00106093774273254
breast carcinoma 1614 0.00111878243150327
group 4 medulloblastoma 1875 0.00154563669694076
psoriasis 6685 0.00156482756662885
atypical teratoid / rhabdoid tumor 4369 0.001791458904889
cutaneous lupus erythematosus 1056 0.00230667684037291
interstitial cystitis 2299 0.00243221488872063
ductal carcinoma in situ 1745 0.0133171680750658
fibroadenoma 557 0.01985153227986
invasive ductal carcinoma 2950 0.0216807007733767

Expression

  Differential Expression (17)

Disease log2 FC p
cutaneous lupus erythematosus 2.300 0.002
psoriasis 1.500 0.002
osteosarcoma -1.839 0.001
atypical teratoid / rhabdoid tumor 1.600 0.002
glioblastoma 1.300 0.000
group 4 medulloblastoma 1.400 0.002
lung cancer -2.700 0.000
breast carcinoma 1.300 0.001
fibroadenoma 1.100 0.020
interstitial cystitis 2.200 0.002
adult high grade glioma 1.200 0.001
primary Sjogren syndrome 1.700 0.000
lung carcinoma -1.100 0.000
ductal carcinoma in situ 1.700 0.013
invasive ductal carcinoma 1.900 0.022
ulcerative colitis 2.300 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q15669
Symbols TTF
ARHH

Gene

  Ortholog (13)

Gene RIF (18)

PMID Text
23850828 Mutations in hematopoiesis-specific Rho GTPases Rac2 and RhoH lead to a wide range of human blood disorders. (Review)
23499578 Our current results indicate differential requirements for RhoH in the development of TCRalphabeta CD8alphaalpha IELs compared to other subsets of T cells including agonist selected T cells.
22850876 RHOH deficiency leads to T cell defects and persistent epidermodysplasia verruciformis-HPV infections.
22689994 conclude that RhoH expression provides a key molecular determinant that allows T cells to switch between sensing chemokine-mediated go signals and TCR-dependent stop signals
22474251 RhoH plays a critical role in prosurvival chronic lymphocytic leukemia cell-cell and cell-microenvironment interactions with this agent.
21473742 Repression of the RHOH gene by JunD
20851766 RhoH is a key adapter protein that maintains LCK in the inactive state, contributing to the regulation of both pre-TCR and TCR signalling during T-cell development.
20738848 propose that RhoH functions as a negative regulator for IL3-induced signals through modulation of the JAK-STAT pathway
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19950172 Data suggest that RhoH function might be regulated by lysosomal degradation of RhoH protein following TCR complex but not BCR activation.
More...

AA Sequence

MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRP      1 - 70
LSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQREMGPHRASCVNAMEGKKLA     71 - 140
QDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF                       141 - 191
//

Text Mined References (41)

PMID Year Title
23850828 2013 Hematopoietic-specific Rho GTPases Rac2 and RhoH and human blood disorders.
23499578 2013 Differential requirement for RhoH in development of TCR?? CD8?? IELs and other types of T cells.
22850876 2012 Human RHOH deficiency causes T cell defects and susceptibility to EV-HPV infections.
22689994 2012 Opposing roles for RhoH GTPase during T-cell migration and activation.
22474251 2012 RhoH is critical for cell-microenvironment interactions in chronic lymphocytic leukemia in mice and humans.
21841780 2011 A genome-wide association study identifies two new risk loci for Graves' disease.
21473742 2011 Repression of the RHOH gene by JunD.
21103055 2010 RhoH regulates subcellular localization of ZAP-70 and Lck in T cell receptor signaling.
20851766 2011 RhoH modulates pre-TCR and TCR signalling by regulating LCK.
20738848 2010 The haematopoietic GTPase RhoH modulates IL3 signalling through regulation of STAT activity and IL3 receptor expression.
More...