Property Summary

NCBI Gene PubMed Count 41
Grant Count 27
R01 Count 22
Funding $1,474,943.09
PubMed Score 85.91
PubTator Score 324.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
cutaneous lupus erythematosus 2.300 0.002
psoriasis 1.500 0.002
osteosarcoma -1.839 0.001
atypical teratoid / rhabdoid tumor 1.600 0.002
glioblastoma 1.300 0.000
group 4 medulloblastoma 1.400 0.002
lung cancer -2.700 0.000
breast carcinoma 1.300 0.001
fibroadenoma 1.100 0.020
interstitial cystitis 2.200 0.002
adult high grade glioma 1.200 0.001
primary Sjogren syndrome 1.700 0.000
lung carcinoma -1.100 0.000
ductal carcinoma in situ 1.700 0.013
invasive ductal carcinoma 1.900 0.022
ulcerative colitis 2.300 0.000
ovarian cancer 1.100 0.000

Gene RIF (18)

PMID Text
23850828 Mutations in hematopoiesis-specific Rho GTPases Rac2 and RhoH lead to a wide range of human blood disorders. (Review)
23499578 Our current results indicate differential requirements for RhoH in the development of TCRalphabeta CD8alphaalpha IELs compared to other subsets of T cells including agonist selected T cells.
22850876 RHOH deficiency leads to T cell defects and persistent epidermodysplasia verruciformis-HPV infections.
22689994 conclude that RhoH expression provides a key molecular determinant that allows T cells to switch between sensing chemokine-mediated go signals and TCR-dependent stop signals
22474251 RhoH plays a critical role in prosurvival chronic lymphocytic leukemia cell-cell and cell-microenvironment interactions with this agent.
21473742 Repression of the RHOH gene by JunD
20851766 RhoH is a key adapter protein that maintains LCK in the inactive state, contributing to the regulation of both pre-TCR and TCR signalling during T-cell development.
20738848 propose that RhoH functions as a negative regulator for IL3-induced signals through modulation of the JAK-STAT pathway
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19950172 Data suggest that RhoH function might be regulated by lysosomal degradation of RhoH protein following TCR complex but not BCR activation.
More...

AA Sequence

MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRP      1 - 70
LSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQREMGPHRASCVNAMEGKKLA     71 - 140
QDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF                       141 - 191
//

Text Mined References (41)

PMID Year Title
23850828 2013 Hematopoietic-specific Rho GTPases Rac2 and RhoH and human blood disorders.
23499578 2013 Differential requirement for RhoH in development of TCR?? CD8?? IELs and other types of T cells.
22850876 2012 Human RHOH deficiency causes T cell defects and susceptibility to EV-HPV infections.
22689994 2012 Opposing roles for RhoH GTPase during T-cell migration and activation.
22474251 2012 RhoH is critical for cell-microenvironment interactions in chronic lymphocytic leukemia in mice and humans.
21841780 2011 A genome-wide association study identifies two new risk loci for Graves' disease.
21473742 2011 Repression of the RHOH gene by JunD.
21103055 2010 RhoH regulates subcellular localization of ZAP-70 and Lck in T cell receptor signaling.
20851766 2011 RhoH modulates pre-TCR and TCR signalling by regulating LCK.
20738848 2010 The haematopoietic GTPase RhoH modulates IL3 signalling through regulation of STAT activity and IL3 receptor expression.
More...