Property Summary

NCBI Gene PubMed Count 81
Grant Count 9
R01 Count 2
Funding $1,722,453.54
PubMed Score 108.03
PubTator Score 73.07

Knowledge Summary

Patent

No data available

Expression

Gene RIF (54)

PMID Text
26089601 Elevated serum tryptase and ET-1 may be markers of increased coronary instability; some cytokines may be related to the extension of CAD.
26044856 We found the determination of serum tryptase levels over time to be a reassuring correlate of clinical improvement in pediatric mastocytosis
25797204 genetic polymorphism is associated with Dengue Hemorrhagic Fever and Dengue Shock Syndrome in Vietnam and Philippines
24915568 Results demonstrated serum tryptase levels in colo-rectal cancer (CRC) patients before radical surgical resection.
24830464 Circulating tryptase level is associated to obesity related parameters and has a close relation with various metabolic risk factors for subclinical atherosclerosis
24806698 these data suggest that the expression of tryptase is regulated by SCF/C-KIT signaling via the ERK1/2 and p38MAPK pathways.
24726923 Urine tryptase beta was increased in patients with chronic prostatitis/chronic pelvic pain syndrome compared to controls.
24565497 With elevated tryptase level, a history of hornet sting-triggered anaphylaxis, and venom-specific IgE, a patient is at increased risk of severe life-threatening anaphylactic response to a future sting, as well as for having underlying clonal mastocytosis.
24507159 The accumulated data in this review suggest that mast cells and their tryptases and chymases play important roles in tissue repair.
24372627 Alpha-tryptase gene variation is associated with levels of circulating IgE and lung function in asthma.
More...

AA Sequence

MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVL      1 - 70
TAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTV     71 - 140
TLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDML    141 - 210
CAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP         211 - 275
//

Text Mined References (89)

PMID Year Title
26089601 2015 Elevated Serum Tryptase and Endothelin in Patients with ST Segment Elevation Myocardial Infarction: Preliminary Report.
26044856 2015 Assessment of clinical findings, tryptase levels, and bone marrow histopathology in the management of pediatric mastocytosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25797204 2015 Alpha tryptase allele of Tryptase 1 (TPSAB1) gene associated with Dengue Hemorrhagic Fever (DHF) and Dengue Shock Syndrome (DSS) in Vietnam and Philippines.
24915568 2014 Correlation between serum tryptase, mast cells positive to tryptase and microvascular density in colo-rectal cancer patients: possible biological-clinical significance.
24830464 2014 Circulating tryptase as a marker for subclinical atherosclerosis in obese subjects.
24806698 2014 SCF/C-KIT signaling modulates tryptase expression in acute myeloid leukemia cells.
24726923 2014 Tryptase-PAR2 axis in experimental autoimmune prostatitis, a model for chronic pelvic pain syndrome.
24565497 Anaphylactic reaction to white-faced hornet sting and elevated baseline (asymptomatic) serum tryptase.
24507159 2014 Development of mast cells and importance of their tryptase and chymase serine proteases in inflammation and wound healing.
More...