Property Summary

Ligand Count 171
NCBI Gene PubMed Count 87
PubMed Score 113.00
PubTator Score 73.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (59)

AA Sequence

MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVL      1 - 70
TAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTV     71 - 140
TLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDML    141 - 210
CAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP         211 - 275
//

Text Mined References (95)

PMID Year Title