Property Summary

NCBI Gene PubMed Count 51
PubMed Score 34.03
PubTator Score 34.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.400 7.2e-05
astrocytoma 2.000 8.4e-03
Astrocytoma, Pilocytic 1.200 3.5e-06
atypical teratoid / rhabdoid tumor 1.800 1.5e-04
breast carcinoma 1.300 4.3e-02
ependymoma 1.900 1.1e-08
glioblastoma 1.200 1.7e-03
group 4 medulloblastoma -1.600 2.2e-05
ovarian cancer 2.600 1.9e-07
pituitary cancer -1.500 3.6e-06
subependymal giant cell astrocytoma 1.946 9.2e-03

Gene RIF (24)

AA Sequence

MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGGPEDRGPAWVG      1 - 70
SHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNP     71 - 140
ASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWG    141 - 210
PGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCG    211 - 280
GCGEDVVGDGAGVVALDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRI    281 - 350
LRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVA    351 - 420
LDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC                  421 - 476
//

Text Mined References (61)

PMID Year Title