Property Summary

NCBI Gene PubMed Count 46
Grant Count 43
R01 Count 31
Funding $2,068,448
PubMed Score 31.20
PubTator Score 34.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma 1.900 0.000
ependymoma 1.900 0.000
astrocytoma 2.000 0.008
atypical teratoid / rhabdoid tumor 1.800 0.000
breast carcinoma 1.300 0.043
pediatric high grade glioma 1.600 0.000
group 4 medulloblastoma -1.600 0.000
pilocytic astrocytoma 1.300 0.000
subependymal giant cell astrocytoma 1.946 0.009
ovarian cancer 2.600 0.000
pituitary cancer -1.500 0.000

Gene RIF (22)

PMID Text
25673849 the Trip6-GRIP1-myosin VI interaction and its regulation on F-actin network play a significant role in dendritic morphogenesis
24033704 TRIP6 acts, in contrast to Zyxin, as an oncogene that partially accounts for the autonomous migratory, invasive and proliferative properties of Ewing's sarcoma cells.
24033704 TRIP6 overexpression promotes migration, invasion, and clonogenicity of Ewing's sarcoma cells
23576104 TRIP6 is involved in the regulation of nasopharyngeal carcinoma cell motility, and phosphorylation of tyrosine 55 residue plays an important regulatory role for this event
23339869 TRIP6 also promotes serum-induced reduction of nuclear p27(KIP1) expression levels.
23313295 High TRIP6 expression is associated with malignant pleural mesothelioma.
22054418 TRIP6 is engaged in cell proliferation, differentiation, transcription regulation and contributes to genome stability. [Review]
22054418 TRIP6 is a nucleocytoplasmatic shuttle protein essential for the coordination of focal adhesion dynamics and transcriptional responses in lysophosphosphatidic (LPA) and NF-kappaB signaling.
21689746 TRIP6 is an adaptor protein that regulates cell motility, antiapoptotic signaling and transcriptional activity. (Review)
20876301 TRIP6 promotes Fas-mediated cell migration in apoptosis-resistant glioma cells. This effect is regulated via the Src-dependent phosphorylation of TRIP6 at Tyr-55.
More...

AA Sequence

MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGGPEDRGPAWVG      1 - 70
SHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNP     71 - 140
ASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWG    141 - 210
PGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCG    211 - 280
GCGEDVVGDGAGVVALDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRI    281 - 350
LRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVA    351 - 420
LDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC                  421 - 476
//

Text Mined References (56)

PMID Year Title
25673849 2015 Trip6 promotes dendritic morphogenesis through dephosphorylated GRIP1-dependent myosin VI and F-actin organization.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24033704 2013 The Zyxin-related protein thyroid receptor interacting protein 6 (TRIP6) is overexpressed in Ewing's sarcoma and promotes migration, invasion and cell growth.
23576104 2013 Characterization of TRIP6-dependent nasopharyngeal cancer cell migration.
23339869 2013 TRIP6 regulates p27 KIP1 to promote tumorigenesis.
23313295 2013 Gene expression profile of aquaporin 1 and associated interactors in malignant pleural mesothelioma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
More...