Property Summary

NCBI Gene PubMed Count 51
Grant Count 18
R01 Count 5
Funding $1,506,928.99
PubMed Score 16.37
PubTator Score 14.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Rheumatoid Arthritis 2.100 0.011
gastric cancer -1.300 0.007
pancreatic cancer -1.100 0.018
interstitial lung disease -1.200 0.043
astrocytic glioma 2.900 0.008
ependymoma 2.600 0.006
oligodendroglioma 2.800 0.005
atypical teratoid / rhabdoid tumor -1.100 0.001
glioblastoma -1.300 0.001
medulloblastoma 1.600 0.004
medulloblastoma, large-cell 1.600 0.000
juvenile dermatomyositis 1.072 0.000
pancreatic ductal adenocarcinoma liver m... 1.907 0.014
non-small cell lung cancer -2.224 0.000
intraductal papillary-mucinous adenoma (... 1.600 0.005
intraductal papillary-mucinous carcinoma... 1.300 0.019
lung cancer -1.300 0.000
diabetes mellitus -1.200 0.022
pancreatic carcinoma -1.100 0.018
breast carcinoma -1.100 0.000
spina bifida -1.275 0.036
Pick disease 1.300 0.000
Breast cancer -1.400 0.000
acute myeloid leukemia 1.100 0.044
ovarian cancer -3.200 0.000
pituitary cancer 1.200 0.000

Gene RIF (16)

PMID Text
26608785 Histone modifier genes (JMJD1C, RREB1, MINA, KDM7A) alter conotruncal heart phenotypes in 22q11.2 deletion syndrome.
26494788 JMJD1C is directly recruited by RUNX1-RUNX1T1 to its target genes and regulates their expression by maintaining low H3K9 dimethyl (H3K9me2) levels
26414697 genetic variants in the androgen-related genes CYP17A1 and JMJD1C might be associated with risk of Barrett's esophagus (BE) and esophageal adenocarcinoma (EAC).
24501218 Depletion of JMJD1C impairs expansion and colony formation of leukemic cell lines, with the strongest effect observed in the MLL-rearranged ALL cell line SEM.
24318875 JMJD1C represses neural differentiation of hESCs at least partially by epigenetically sustaining miR-302 expression
24240613 JMJD1C regulates the RAP80-BRCA1 branch of this DNA-damage response (DDR) pathway.
23593242 No evidence for JMJD1C histone demethylase activity towards H3K9.
20648472 Observational study of gene-disease association. (HuGE Navigator)
20526338 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MAVETRAELVGKRFLCVAVGDEARSERWESGRGWRSWRAGVIRAVSHRDSRNPDLAVYVEFDDLEWDKRE      1 - 70
WVKVYEDFSTFLVEYHLIWAKRNDPSQTQGSKSKQIQWPALTFKPLVERNIPSSVTAVEFLVDKQLDFLT     71 - 140
EDSAFQPYQDDIDSLNPVLRDNPQLHEEVKVWVKEQKVQEIFMQGPYSLNGYRVRVYRQDSATQWFTGII    141 - 210
THHDLFTRTMIVMNDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRANQNVNAVHSHYTRA    211 - 280
QANSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSDSSIPDEEKMKEEKYDYISRGENPKGKNKHLMN    281 - 350
KRRKPEEDEKKLNMKRLRTDNVSDFSESSDSENSNKRIIDNSSEQKPENELKNKNTSKINGEEGKPHNNE    351 - 420
KAGEETLKNSQPPWDQIQEDKKHEEAEKRKSVDTQLQEDMIIHSSEQSTVSDHNSNDLLPQECNMDKTHT    421 - 490
MELLPKEKFVSRPPTPKCVIDITNDTNLEKVAQENSSTFGLQTLQKMDPNVSDSKHSIANAKFLETAKKD    491 - 560
SDQSWVSDVVKVDLTQSSVTNASSGNDHLNMEKEKYVSYISPLSAVSVMEDKLHKRSPPPETIKSKLNTS    561 - 630
VDTHKIKSSPSPEVVKPKITHSPDSVKSKATYVNSQATGERRLANKIEHELSRCSFHPIPTRSSTLETTK    631 - 700
SPLIIDKNEHFTVYRDPALIGSETGANHISPFLSQHPFPLHSSSHRTCLNPGTHHPALTPAPHLLAGSSS    701 - 770
QTPLPTINTHPLTSGPHHAVHHPHLLPTVLPGVPTASLLGGHPRLESAHASSLSHLALAHQQQQQLLQHQ    771 - 840
SPHLLGQAHPSASYNQLGLYPIIWQYPNGTHAYSGLGLPSSKWVHPENAVNAEASLRRNSPSPWLHQPTP    841 - 910
VTSADGIGLLSHIPVRPSSAEPHRPLKITAHSSPPLTKTLVDHHKEELERKAFMEPLRSVASTSAKNDLD    911 - 980
LNRSQTGKDCHLHRHFVDPVLNQLQRPPQETGERLNKYKEEHRRILQESIDVAPFTTKIKGLEGERENYS    981 - 1050
RVASSSSSPKSHIIKQDMDVERSVSDLYKMKHSVPQSLPQSNYFTTLSNSVVNEPPRSYPSKEVSNIYGD   1051 - 1120
KQSNALAAAAANPQTLTSFITSLSKPPPLIKHQPESEGLVGKIPEHLPHQIASHSVTTFRNDCRSPTHLT   1121 - 1190
VSSTNTLRSMPALHRAPVFHPPIHHSLERKEGSYSSLSPPTLTPVMPVNAGGKVQESQKPPTLIPEPKDS   1191 - 1260
QANFKSSSEQSLTEMWRPNNNLSKEKTEWHVEKSSGKLQAAMASVIVRPSSSTKTDSMPAMQLASKDRVS   1261 - 1330
ERSSAGAHKTDCLKLAEAGETGRIILPNVNSDSVHTKSEKNFQAVSQGSVPSSVMSAVNTMCNTKTDVIT   1331 - 1400
SAADTTSVSSWGGSEVISSLSNTILASTSSECVSSKSVSQPVAQKQECKVSTTAPVTLASSKTGSVVQPS   1401 - 1470
SGFSGTTDFIHLKKHKAALAAAQYKSSNASETEPNAIKNQTLSASLPLDSTVICSTINKANSVGNGQASQ   1471 - 1540
TSQPNYHTKLKKAWLTRHSEEDKNTNKMENSGNSVSEIIKPCSVNLIASTSSDIQNSVDSKIIVDKYVKD   1541 - 1610
DKVNRRKAKRTYESGSESGDSDESESKSEQRTKRQPKPTYKKKQNDLQKRKGEIEEDLKPNGVLSRSAKE   1611 - 1680
RSKLKLQSNSNTGIPRSVLKDWRKVKKLKQTGESFLQDDSCCEIGPNLQKCRECRLIRSKKGEEPAHSPV   1681 - 1750
FCRFYYFRRLSFSKNGVVRIDGFSSPDQYDDEAMSLWTHENFEDDELDIETSKYILDIIGDKFCQLVTSE   1751 - 1820
KTALSWVKKDAKIAWKRAVRGVREMCDACEATLFNIHWVCQKCGFVVCLDCYKAKERKSSRDKELYAWMK   1821 - 1890
CVKGQPHDHKHLMPTQIIPGSVLTDLLDAMHTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQVLQNVL   1891 - 1960
NHSNKISLCMPESQQQNTPPKSEKNGGSSPESDVGTDNKLTPPESQSPLHWLADLAEQKAREEKKENKEL   1961 - 2030
TLENQIKEEREQDNSESPNGRTSPLVSQNNEQGSTLRDLLTTTAGKLRVGSTDAGIAFAPVYSMGAPSSK   2031 - 2100
SGRTMPNILDDIIASVVENKIPPSKTSKINVKPELKEEPEESIISAVDENNKLYSDIPHSWICEKHILWL   2101 - 2170
KDYKNSSNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGDHQADLLNCKDSIISNANVKEFWD   2171 - 2240
GFEEVSKRQKNKSGETVVLKLKDWPSGEDFKTMMPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRP   2241 - 2310
DLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRL   2311 - 2380
KDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTL   2381 - 2450
IQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELRLLKEEINYDDKLQVKNILYHAV   2451 - 2520
KEMVRALKIHEDEVEDMEEN                                                     2521 - 2540
//

Text Mined References (58)

PMID Year Title
26987799 2016 DNA damage signalling barrier, oxidative stress and treatment-relevant DNA repair factor alterations during progression of human prostate cancer.
26910538 2016 Six Novel Loci Associated with Circulating VEGF Levels Identified by a Meta-analysis of Genome-Wide Association Studies.
26878175 2016 MLL-AF9- and HOXA9-mediated acute myeloid leukemia stem cell self-renewal requires JMJD1C.
26608785 2015 Histone Modifier Genes Alter Conotruncal Heart Phenotypes in 22q11.2 Deletion Syndrome.
26584805 2015 A genome-wide association study of n-3 and n-6 plasma fatty acids in a Singaporean Chinese population.
26519038 2016 Replication and hematological characterization of human platelet reactivity genetic associations in men from the Caerphilly Prospective Study (CaPS).
26494788 2015 JMJD1C is required for the survival of acute myeloid leukemia by functioning as a coactivator for key transcription factors.
26414697 2016 Polymorphisms in genes in the androgen pathway and risk of Barrett's esophagus and esophageal adenocarcinoma.
26181491 2016 Mutations in JMJD1C are involved in Rett syndrome and intellectual disability.
25714495 2015 The emerging role of lysine demethylases in DNA damage response: dissecting the recruitment mode of KDM4D/JMJD2D to DNA damage sites.
More...