Property Summary

NCBI Gene PubMed Count 53
PubMed Score 20.17
PubTator Score 14.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Kidney cancer 2613 0.0 0.9
Liver cancer 604 0.0 0.7
Disease Target Count Z-score Confidence
Persistent hyperplastic primary vitreous 20 3.526 1.8
Disease Target Count
22q11.2 deletion syndrome 8

Expression

  Differential Expression (26)

Disease log2 FC p
acute myeloid leukemia 1.100 4.4e-02
astrocytic glioma 1.200 3.9e-02
atypical teratoid / rhabdoid tumor -1.100 1.1e-03
Breast cancer -1.200 8.2e-15
breast carcinoma -1.100 9.6e-13
diabetes mellitus -1.200 2.2e-02
ependymoma 2.600 5.9e-03
gastric cancer -1.300 7.2e-03
glioblastoma -1.300 1.4e-03
group 4 medulloblastoma 1.600 5.1e-03
interstitial lung disease -1.200 4.3e-02
intraductal papillary-mucinous adenoma (... 1.600 4.8e-03
intraductal papillary-mucinous carcinoma... 1.300 1.9e-02
juvenile dermatomyositis 1.072 4.1e-12
lung cancer -1.300 1.2e-04
medulloblastoma, large-cell -1.500 8.9e-03
non-small cell lung cancer -2.224 1.5e-18
oligodendroglioma 2.800 4.7e-03
ovarian cancer -1.200 5.8e-04
pancreatic cancer -1.100 1.8e-02
pancreatic carcinoma -1.100 1.8e-02
pancreatic ductal adenocarcinoma liver m... 1.907 1.4e-02
Pick disease 1.300 1.9e-06
pituitary cancer 1.200 5.8e-05
Rheumatoid arthritis 2.100 1.1e-02
spina bifida -1.275 3.6e-02

Gene RIF (19)

AA Sequence

MAVETRAELVGKRFLCVAVGDEARSERWESGRGWRSWRAGVIRAVSHRDSRNPDLAVYVEFDDLEWDKRE      1 - 70
WVKVYEDFSTFLVEYHLIWAKRNDPSQTQGSKSKQIQWPALTFKPLVERNIPSSVTAVEFLVDKQLDFLT     71 - 140
EDSAFQPYQDDIDSLNPVLRDNPQLHEEVKVWVKEQKVQEIFMQGPYSLNGYRVRVYRQDSATQWFTGII    141 - 210
THHDLFTRTMIVMNDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRANQNVNAVHSHYTRA    211 - 280
QANSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSDSSIPDEEKMKEEKYDYISRGENPKGKNKHLMN    281 - 350
KRRKPEEDEKKLNMKRLRTDNVSDFSESSDSENSNKRIIDNSSEQKPENELKNKNTSKINGEEGKPHNNE    351 - 420
KAGEETLKNSQPPWDQIQEDKKHEEAEKRKSVDTQLQEDMIIHSSEQSTVSDHNSNDLLPQECNMDKTHT    421 - 490
MELLPKEKFVSRPPTPKCVIDITNDTNLEKVAQENSSTFGLQTLQKMDPNVSDSKHSIANAKFLETAKKD    491 - 560
SDQSWVSDVVKVDLTQSSVTNASSGNDHLNMEKEKYVSYISPLSAVSVMEDKLHKRSPPPETIKSKLNTS    561 - 630
VDTHKIKSSPSPEVVKPKITHSPDSVKSKATYVNSQATGERRLANKIEHELSRCSFHPIPTRSSTLETTK    631 - 700
SPLIIDKNEHFTVYRDPALIGSETGANHISPFLSQHPFPLHSSSHRTCLNPGTHHPALTPAPHLLAGSSS    701 - 770
QTPLPTINTHPLTSGPHHAVHHPHLLPTVLPGVPTASLLGGHPRLESAHASSLSHLALAHQQQQQLLQHQ    771 - 840
SPHLLGQAHPSASYNQLGLYPIIWQYPNGTHAYSGLGLPSSKWVHPENAVNAEASLRRNSPSPWLHQPTP    841 - 910
VTSADGIGLLSHIPVRPSSAEPHRPLKITAHSSPPLTKTLVDHHKEELERKAFMEPLRSVASTSAKNDLD    911 - 980
LNRSQTGKDCHLHRHFVDPVLNQLQRPPQETGERLNKYKEEHRRILQESIDVAPFTTKIKGLEGERENYS    981 - 1050
RVASSSSSPKSHIIKQDMDVERSVSDLYKMKHSVPQSLPQSNYFTTLSNSVVNEPPRSYPSKEVSNIYGD   1051 - 1120
KQSNALAAAAANPQTLTSFITSLSKPPPLIKHQPESEGLVGKIPEHLPHQIASHSVTTFRNDCRSPTHLT   1121 - 1190
VSSTNTLRSMPALHRAPVFHPPIHHSLERKEGSYSSLSPPTLTPVMPVNAGGKVQESQKPPTLIPEPKDS   1191 - 1260
QANFKSSSEQSLTEMWRPNNNLSKEKTEWHVEKSSGKLQAAMASVIVRPSSSTKTDSMPAMQLASKDRVS   1261 - 1330
ERSSAGAHKTDCLKLAEAGETGRIILPNVNSDSVHTKSEKNFQAVSQGSVPSSVMSAVNTMCNTKTDVIT   1331 - 1400
SAADTTSVSSWGGSEVISSLSNTILASTSSECVSSKSVSQPVAQKQECKVSTTAPVTLASSKTGSVVQPS   1401 - 1470
SGFSGTTDFIHLKKHKAALAAAQYKSSNASETEPNAIKNQTLSASLPLDSTVICSTINKANSVGNGQASQ   1471 - 1540
TSQPNYHTKLKKAWLTRHSEEDKNTNKMENSGNSVSEIIKPCSVNLIASTSSDIQNSVDSKIIVDKYVKD   1541 - 1610
DKVNRRKAKRTYESGSESGDSDESESKSEQRTKRQPKPTYKKKQNDLQKRKGEIEEDLKPNGVLSRSAKE   1611 - 1680
RSKLKLQSNSNTGIPRSVLKDWRKVKKLKQTGESFLQDDSCCEIGPNLQKCRECRLIRSKKGEEPAHSPV   1681 - 1750
FCRFYYFRRLSFSKNGVVRIDGFSSPDQYDDEAMSLWTHENFEDDELDIETSKYILDIIGDKFCQLVTSE   1751 - 1820
KTALSWVKKDAKIAWKRAVRGVREMCDACEATLFNIHWVCQKCGFVVCLDCYKAKERKSSRDKELYAWMK   1821 - 1890
CVKGQPHDHKHLMPTQIIPGSVLTDLLDAMHTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQVLQNVL   1891 - 1960
NHSNKISLCMPESQQQNTPPKSEKNGGSSPESDVGTDNKLTPPESQSPLHWLADLAEQKAREEKKENKEL   1961 - 2030
TLENQIKEEREQDNSESPNGRTSPLVSQNNEQGSTLRDLLTTTAGKLRVGSTDAGIAFAPVYSMGAPSSK   2031 - 2100
SGRTMPNILDDIIASVVENKIPPSKTSKINVKPELKEEPEESIISAVDENNKLYSDIPHSWICEKHILWL   2101 - 2170
KDYKNSSNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGDHQADLLNCKDSIISNANVKEFWD   2171 - 2240
GFEEVSKRQKNKSGETVVLKLKDWPSGEDFKTMMPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRP   2241 - 2310
DLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRL   2311 - 2380
KDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTL   2381 - 2450
IQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELRLLKEEINYDDKLQVKNILYHAV   2451 - 2520
KEMVRALKIHEDEVEDMEEN                                                     2521 - 2540
//

Text Mined References (61)

PMID Year Title