Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.53
PubTator Score 8.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 3.3e-05
Multiple myeloma 1332 9.5e-04
chronic rhinosinusitis 512 3.4e-02

Expression

  Differential Expression (3)

Disease log2 FC p
chronic rhinosinusitis -1.043 3.4e-02
Multiple myeloma 1.690 9.5e-04
ovarian cancer -1.400 3.3e-05

Gene RIF (2)

AA Sequence

MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEA      1 - 70
GKEGTAPSENGETKAEEAQKTESVDNEGE                                              71 - 99
//

Text Mined References (21)

PMID Year Title