Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.31
PubTator Score 8.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 3.32302013318896E-5
Multiple myeloma 1328 9.5416609042699E-4
chronic rhinosinusitis 512 0.03355022836152

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.690 0.001
ovarian cancer -1.400 0.000
chronic rhinosinusitis -1.043 0.034

Synonym

Accession Q15651 B2RD37 Q5HYD3 Q7RTT0 Q969M5 Q9BZT7
Symbols TRIP7
PNAS-24
PNAS-25

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (2)

PMID Text
21947420 The SNPs in the region of HMGN3 gene formed a tightly combined haplotype block in both Chinese and Caucasians. The results suggest that the genomic region containing HMGN3 gene may be associated with spine BS in Chinese.
19651901 loss of HMGN3 impairs glucose-stimulated insulin secretion and leads to a diabetic phenotype.

AA Sequence

MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEA      1 - 70
GKEGTAPSENGETKAEEAQKTESVDNEGE                                              71 - 99
//

Text Mined References (21)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21947420 2012 Genome-wide association study identifies HMGN3 locus for spine bone size variation in Chinese.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19651901 2009 The nucleosome binding protein HMGN3 modulates the transcription profile of pancreatic beta cells and affects insulin secretion.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...