Property Summary

NCBI Gene PubMed Count 12
Grant Count 2
R01 Count 2
Funding $274,030.5
PubMed Score 3.24
PubTator Score 8.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.700 0.010
group 3 medulloblastoma 1.900 0.000
glioblastoma 1.100 0.003
diabetes mellitus -1.300 0.001
ovarian cancer 1.500 0.001

Synonym

Accession Q15650 B2RAS0 Q96ED7 Q9UKH0 ASC-1
Symbols ASC1
ASC-1
MDCDC
SMABF1
ZC2HC5
HsT17391

Gene

 Grant Application (2)

PDB

2E5O  

Gene RIF (2)

PMID Text
24495969 GWAS in a large Spanish sample identifies TRIP4 (rs74615166) as a significant locus for Alzheimer's disease risk.
19074642 Gastrin activates paracrine networks leading to induction of PAI-2 via MAZ and ASC-1.

AA Sequence

MAVAGAVSGEPLVHWCTQQLRKTFGLDVSEEIIQYVLSIESAEEIREYVTDLLQGNEGKKGQFIEELITK      1 - 70
WQKNDQELISDPLQQCFKKDEILDGQKSGDHLKRGRKKGRNRQEVPAFTEPDTTAEVKTPFDLAKAQENS     71 - 140
NSVKKKTKFVNLYTREGQDRLAVLLPGRHPCDCLGQKHKLINNCLICGRIVCEQEGSGPCLFCGTLVCTH    141 - 210
EEQDILQRDSNKSQKLLKKLMSGVENSGKVDISTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRT    211 - 280
QVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLD    281 - 350
ETIQAIANGTLNQPLTKLDRSSEEPLGVLVNPNMYQSPPQWVDHTGAASQKKAFRSSGFGLEFNSFQHQL    351 - 420
RIQDQEFQEGFDGGWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSELQATYRL    421 - 490
LRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIW    491 - 560
KLDSKIHQGAKKGLMKQNKAV                                                     561 - 581
//

Text Mined References (20)

PMID Year Title
26924529 2016 Mutations in Subunits of the Activating Signal Cointegrator 1 Complex Are Associated with Prenatal Spinal Muscular Atrophy and Congenital Bone Fractures.
25219498 2014 Modification of ASC1 by UFM1 is crucial for ER? transactivation and breast cancer development.
24495969 2014 Follow-up of loci from the International Genomics of Alzheimer's Disease Project identifies TRIP4 as a novel susceptibility gene.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20873783 2010 Characterization of hNek6 interactome reveals an important role for its short N-terminal domain and colocalization with proteins at the centrosome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19074642 2009 Gastrin activates paracrine networks leading to induction of PAI-2 via MAZ and ASC-1.
More...