Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.86
PubTator Score 8.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.700 1.0e-02
diabetes mellitus -1.300 1.0e-03
glioblastoma 1.100 2.8e-03
group 3 medulloblastoma 1.900 7.4e-06
ovarian cancer -1.200 2.3e-06

Gene RIF (3)

AA Sequence

MAVAGAVSGEPLVHWCTQQLRKTFGLDVSEEIIQYVLSIESAEEIREYVTDLLQGNEGKKGQFIEELITK      1 - 70
WQKNDQELISDPLQQCFKKDEILDGQKSGDHLKRGRKKGRNRQEVPAFTEPDTTAEVKTPFDLAKAQENS     71 - 140
NSVKKKTKFVNLYTREGQDRLAVLLPGRHPCDCLGQKHKLINNCLICGRIVCEQEGSGPCLFCGTLVCTH    141 - 210
EEQDILQRDSNKSQKLLKKLMSGVENSGKVDISTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRT    211 - 280
QVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLD    281 - 350
ETIQAIANGTLNQPLTKLDRSSEEPLGVLVNPNMYQSPPQWVDHTGAASQKKAFRSSGFGLEFNSFQHQL    351 - 420
RIQDQEFQEGFDGGWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSELQATYRL    421 - 490
LRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIW    491 - 560
KLDSKIHQGAKKGLMKQNKAV                                                     561 - 581
//

Text Mined References (21)

PMID Year Title