Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.84
PubTator Score 5.33

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
19596656 Results identify TRIP3 as a novel regulator of PPARgamma-mediated adipocyte differentiation.
19149918 A high GYPC gene expression is associated with an unfavorable outcome, in contrast, a high TRIP3 gene expression is associated with a favorable outcome in childhood ALL.

AA Sequence

MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDD      1 - 70
DDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFA     71 - 140
DCCLGIVEPSQNEES                                                           141 - 155
//

Text Mined References (14)

PMID Year Title
25170085 2014 Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19596656 2009 Nuclear receptor-coregulator interaction profiling identifies TRIP3 as a novel peroxisome proliferator-activated receptor gamma cofactor.
19149918 2009 [Relationship between expression of GYPC and TRIP3 genes and prognosis of acute lymphoblastic leukemia in children].
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...