Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.12
PubTator Score 5.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia -1.200 2.1e-03
adult high grade glioma -1.100 3.7e-03
astrocytic glioma -1.300 3.6e-02
ependymoma -1.300 4.8e-02
glioblastoma -1.100 2.1e-03
lung cancer 1.600 5.3e-03
Multiple myeloma 1.141 6.2e-03
osteosarcoma -1.116 3.2e-02
ovarian cancer -1.700 3.0e-05

Gene RIF (4)

AA Sequence

MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDD      1 - 70
DDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFA     71 - 140
DCCLGIVEPSQNEES                                                           141 - 155
//

Text Mined References (16)

PMID Year Title