Property Summary

NCBI Gene PubMed Count 100
PubMed Score 79.62
PubTator Score 139.13

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
acute quadriplegic myopathy 1157 1.08198197169722E-7
atypical teratoid / rhabdoid tumor 4369 2.18597014574173E-7
primitive neuroectodermal tumor 3031 8.66406484855125E-7
malignant mesothelioma 3163 1.05141804332269E-6
glioblastoma 5572 7.77710291550558E-6
Pick disease 1893 9.0645085811331E-6
pituitary cancer 1972 2.42378426289042E-5
Rheumatoid Arthritis 1171 4.79461123558479E-5
medulloblastoma, large-cell 6234 6.43258111673293E-5
lung cancer 4473 1.06689511652389E-4
ovarian cancer 8492 3.53511022012393E-4
group 3 medulloblastoma 2254 3.55383347028683E-4
osteosarcoma 7933 0.00124323970362133
astrocytoma 1493 0.00537606364432786
non primary Sjogren syndrome sicca 840 0.0201493730310254
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0


  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.800 0.000
malignant mesothelioma 1.900 0.000
osteosarcoma 1.072 0.001
group 3 medulloblastoma 1.800 0.000
astrocytoma 1.300 0.005
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.100 0.000
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 1.600 0.000
acute quadriplegic myopathy 1.192 0.000
lung cancer 1.300 0.000
non primary Sjogren syndrome sicca -1.200 0.020
Pick disease 1.200 0.000
ovarian cancer 1.200 0.000
pituitary cancer 1.100 0.000


Accession Q15648 A2RRQ6 O43810 O75447 Q6P9H7 Q6PK58 Q9HD39
Symbols PBP



1RJK   1RK3   1RKG   1RKH   2O4J   2O4R   2ZFX   3A2H   3AUN   3VJS   3VJT   3VRT   3VRU   3VRV   3VRW   3W0G   3W0H   3W0I   3W0J   3W5P   3W5Q   3W5R   3W5T   3WT5   3WT6   3WT7   3WTQ   4YNK   5AWJ   5AWK   5B5B  

  Ortholog (13)

Gene RIF (57)

26469385 HIV-1 MA upregulates MED1 mRNA expression in HepG2 cells
25644605 MED1 is required for optimal PRDM16-induced Ucp1 expression
25481872 Our data indicate that MED1 serves as a key mediator in ARv567es induced gene expression
24969180 Results show that miR-1 is downregulated in osteosarcoma cells but both of its targets Med1 and Med31 were overexpressed suggesting that MiR-1 plays an important role on the proliferation of osteosarcoma cells through regulation of Med1 and Med31.
24418047 no association between SCZ and the SNPs of VDR, suggesting that VDR is not a major gene for SCZ in Chinese Han population. However, our data indicate a potential involvement of VDR SNPs in the susceptibility of risperidone-treated patients to MetS
24245781 multiple modes of the GATA1-MED1 axis may help to fine-tune GATA1 function during GATA1-mediated homeostasis events.
23936234 These results demonstrate a role for MED1 in mediating resistance to the pure anti-estrogen fulvestrant both in vitro and in vivo.
23538858 hyperactivated ERK and/or AKT signaling pathways promoted MED1 overexpression in prostate cancer cells.
23160722 Data concluded that those of VDR ff genotype may be regarded as "low responders" to vitamin D intake in terms of response of circulating 25(OH)D and certain inflammatory biomarkers.
22964581 MED1 is recruited to the HER2 gene and required for its expression.

AA Sequence

DQSLSMTSNTILSADRPSRLSPDFMIGEEDDDLMDVALIGN                                1541 - 1581

Text Mined References (119)

PMID Year Title
25644605 2015 PRDM16 enhances nuclear receptor-dependent transcription of the brown fat-specific Ucp1 gene through interactions with Mediator subunit MED1.
25481872 2015 MED1 mediates androgen receptor splice variant induced gene expression in the absence of ligand.
25303530 2014 Enhancer activation requires trans-recruitment of a mega transcription factor complex.
24969180 2014 MicroRNA-1 functions as a potential tumor suppressor in osteosarcoma by targeting Med1 and Med31.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24418047 2014 Effects of vitamin D receptor polymorphisms on the risk of schizophrenia and metabolic changes caused by risperidone treatment.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24245781 2014 CCAR1/CoCoA pair-mediated recruitment of the Mediator defines a novel pathway for GATA1 function.