Property Summary

NCBI Gene PubMed Count 104
PubMed Score 83.28
PubTator Score 139.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.192 1.1e-07
astrocytoma 1.300 5.4e-03
atypical teratoid / rhabdoid tumor 1.500 2.2e-07
glioblastoma 1.100 7.8e-06
group 3 medulloblastoma 1.800 3.6e-04
lung cancer 1.200 7.8e-04
malignant mesothelioma 1.900 1.1e-06
medulloblastoma, large-cell 1.800 6.4e-05
non primary Sjogren syndrome sicca -1.200 2.0e-02
osteosarcoma 1.072 1.2e-03
ovarian cancer 1.200 3.5e-04
Pick disease 1.100 4.4e-06
pituitary cancer 1.100 2.4e-05
primitive neuroectodermal tumor 1.600 8.7e-07
Rheumatoid arthritis 1.800 4.8e-05

Gene RIF (59)

AA Sequence

MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALK      1 - 70
VTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQ     71 - 140
QLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGY    141 - 210
LTPRSGGHLMNLKYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAVYKLPIAPLIMGSHPV    211 - 280
DNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYAPLYELITQFELSK    281 - 350
DPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTL    351 - 420
IGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICT    421 - 490
DDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGYGMTTGNNPMSGT    491 - 560
TTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPP    561 - 630
PVSSMAGNTKNHPMLMNLLKDNPAQDFSTLYGSSPLERQNSSSGSPRMEICSGSNKTKKKKSSRLPPEKP    631 - 700
KHQTEDDFQRELFSMDVDSQNPIFDVNMTADTLDTPHITPAPSQCSTPPTTYPQPVPHPQPSIQRMVRLS    701 - 770
SSDSIGPDVTDILSDIAEEASKLPSTSDDCPAIGTPLRDSSSSGHSQSTLFDSDVFQTNNNENPYTDPAD    771 - 840
LIADAAGSPSSDSPTNHFFHDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFASQALNTLGVPM    841 - 910
LGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSN    911 - 980
STLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPFTPPTSTGGSKSPGSAGRSQ    981 - 1050
TPPGVATPPIPKITIQIPKGTVMVGKPSSHSQYTSSGSVSSSGSKSHHSHSSSSSSSASTSGKMKSSKSE   1051 - 1120
GSSSSKLSSSMYSSQGSSGSSQSKNSSQSGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSLSKPN   1121 - 1190
ISPSHSRPPGGSDKLASPMKPVPGTPPSSKAKSPISSGSGGSHMSGTSSSSGMKSSSGLGSSGSLSQKTP   1191 - 1260
PSSNSCTASSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPGGEDPLDGQMG   1261 - 1330
VSTNSSSHPMSSKHNMSGGEFQGKREKSDKDKSKVSTSGSSVDSSKKTSESKNVGSTGVAKIIISKHDGG   1331 - 1400
SPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSS   1401 - 1470
IAEKSYQNSPSSDDGIRPLPEYSTEKHKKHKKEKKKVKDKDRDRDRDKDRDKKKSHSIKPESWSKSPISS   1471 - 1540
DQSLSMTSNTILSADRPSRLSPDFMIGEEDDDLMDVALIGN                                1541 - 1581
//

Text Mined References (123)

PMID Year Title