Property Summary

NCBI Gene PubMed Count 36
Grant Count 2
R01 Count 2
Funding $190,431.9
PubMed Score 31.75
PubTator Score 29.30

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15646 B2RAZ2 I1YDD2 O75686 Q17R95 Q9Y6K6 Q9Y6K7
Symbols OASLd
TRIP14
TRIP-14
p59OASL
p59 OASL
p59-OASL

Gene

 Grant Application (2)

PDB

1WH3   4XQ7  

Gene RIF (20)

PMID Text
26178980 OASL acts as a cellular antiviral protein and RSV NS1 suppresses this function to evade cellular innate immunity and allow virus growth.
26116899 HIV-1 Vpr upregulates the gene expression of OASL in human monocyte-derived dendritic cells
24931123 these findings show a mechanism by which human OASL contributes to host antiviral responses by enhancing RIG-I activation.
24742347 HIV-1 Vpr upregulates the gene expression of OASL in human monocyte-derived dendritic cells
24328427 Primary mononuclear cells from patients with systemic sclerosis have increased basal levels of OASL and OAS2 genes.
23306614 we propose that VSV treatment combined with the selective regulation of genes such as STAT1 and OASL2 will improve therapeutic outcomes for CUG2-overexpressing tumors
21943158 variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits
21050126 Observational study of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLDAVRTVEEFLRQEHFQGKRGLDQDVRVLKVVKVGSF      1 - 70
GNGTVLRSTREVELVAFLSCFHSFQEAAKHHKDVLRLIWKTMWQSQDLLDLGLEDLRMEQRVPDALVFTI     71 - 140
QTRGTAEPITVTIVPAYRALGPSLPNSQPPPEVYVSLIKACGGPGNFCPSFSELQRNFVKHRPTKLKSLL    141 - 210
RLVKHWYQQYVKARSPRANLPPLYALELLTIYAWEMGTEEDENFMLDEGFTTVMDLLLEYEVICIYWTKY    211 - 280
YTLHNAIIEDCVRKQLKKERPIILDPADPTLNVAEGYRWDIVAQRASQCLKQDCCYDNRENPISSWNVKR    281 - 350
ARDIHLTVEQRGYPDFNLIVNPYEPIRKVKEKIRRTRGYSGLQRLSFQVPGSERQLLSSRCSLAKYGIFS    351 - 420
HTHIYLLETIPSEIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLG    421 - 490
IYGIQDSDTLILSKKKGEALFPAS                                                  491 - 514
//

Text Mined References (40)

PMID Year Title
26178980 2015 2'-5'-Oligoadenylate Synthetase-Like Protein Inhibits Respiratory Syncytial Virus Replication and Is Targeted by the Viral Nonstructural Protein 1.
24931123 2014 Antiviral activity of human OASL protein is mediated by enhancing signaling of the RIG-I RNA sensor.
24763700 2014 New variants including ARG1 polymorphisms associated with C-reactive protein levels identified by genome-wide association and pathway analysis.
24328427 2014 Differential upregulation of human 2'5'OAS genes on systemic sclerosis: Detection of increased basal levels of OASL and OAS2 genes through a qPCR based assay.
23306614 2013 Cancer upregulated gene 2, a novel oncogene, confers resistance to oncolytic vesicular stomatitis virus through STAT1-OASL2 signaling.
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22531715 2012 Identification of OASL d, a splice variant of human OASL, with antiviral activity.
21943158 2011 Genetic variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits.
More...