Property Summary

NCBI Gene PubMed Count 20
Grant Count 29
R01 Count 22
Funding $3,831,756.46
PubMed Score 73.87
PubTator Score 7.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Pathway (1)

Gene RIF (6)

PMID Text
26832417 These results establish a paradigm of the roles of p31(comet) and TRIP13 in both checkpoint activation and inactivation.
26324890 the oligomeric form of TRIP13 binds both p31(comet) and MCC
25092294 propose that TRIP13 plays centrally important roles in the sequence of events leading to MCC disassembly and checkpoint inactivation
25078033 TRIP13 promotes error-prone non-homologous end joining and induces chemoresistance in head and neck cancer.
25012665 suggest that premature mitotic checkpoint silencing triggered by TRIP13 overexpression may promote cancer development
22174317 HIV-1 Rev interacting protein, thyroid hormone receptor interactor 13 (TRIP13), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MDEAVGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHNIVFGDYTWTEFDEPFLTRNV      1 - 70
QSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEFHGLWDSLV     71 - 140
YDVEVKSHLLDYVMTTLLFSDKNVNSNLITWNRVVLLHGPPGTGKTSLCKALAQKLTIRLSSRYRYGQLI    141 - 210
EINSHSLFSKWFSESGKLVTKMFQKIQDLIDDKDALVFVLIDEVESLTAARNACRAGTEPSDAIRVVNAV    211 - 280
LTQIDQIKRHSNVVILTTSNITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQL    281 - 350
LTLRELEMIGFIENNVSKLSLLLNDISRKSEGLSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDK    351 - 420
QFEERKKLAAYI                                                              421 - 432
//

Text Mined References (26)

PMID Year Title
26832417 2016 TRIP13 Regulates Both the Activation and Inactivation of the Spindle-Assembly Checkpoint.
26324890 2015 Mode of interaction of TRIP13 AAA-ATPase with the Mad2-binding protein p31comet and with mitotic checkpoint complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25092294 2014 Disassembly of mitotic checkpoint complexes by the joint action of the AAA-ATPase TRIP13 and p31(comet).
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
25078033 2014 TRIP13 promotes error-prone nonhomologous end joining and induces chemoresistance in head and neck cancer.
25012665 2014 Thyroid hormone receptor interacting protein 13 (TRIP13) AAA-ATPase is a novel mitotic checkpoint-silencing protein.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
More...