Property Summary

NCBI Gene PubMed Count 25
PubMed Score 63.82
PubTator Score 7.78

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma 1.810 2.7e-03
Atopic dermatitis 1.100 3.2e-04
atypical teratoid/rhabdoid tumor 1.200 4.5e-05
Breast cancer 1.900 5.3e-09
breast carcinoma 1.300 1.1e-26
chronic rhinosinusitis -2.081 1.9e-02
colon cancer 1.200 4.0e-02
ductal carcinoma in situ 1.600 7.1e-03
Endometriosis 1.100 1.9e-02
glioblastoma 1.100 4.2e-03
group 3 medulloblastoma 1.900 2.5e-03
intraductal papillary-mucinous carcinoma... 2.300 6.8e-04
intraductal papillary-mucinous neoplasm ... 2.300 3.2e-04
invasive ductal carcinoma 2.300 3.2e-04
lung adenocarcinoma 1.200 7.0e-09
lung cancer 2.100 2.1e-05
malignant mesothelioma 1.600 1.8e-07
medulloblastoma, large-cell 1.600 3.3e-03
non-small cell lung cancer 3.104 2.7e-27
ovarian cancer 2.400 4.2e-07
pancreatic cancer 1.200 1.6e-04
pituitary cancer -1.800 2.1e-04
primitive neuroectodermal tumor 1.200 3.5e-02
psoriasis 1.500 1.8e-14
ulcerative colitis 1.300 3.4e-05

Protein-protein Interaction (7)

Gene RIF (8)

AA Sequence

MDEAVGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHNIVFGDYTWTEFDEPFLTRNV      1 - 70
QSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEFHGLWDSLV     71 - 140
YDVEVKSHLLDYVMTTLLFSDKNVNSNLITWNRVVLLHGPPGTGKTSLCKALAQKLTIRLSSRYRYGQLI    141 - 210
EINSHSLFSKWFSESGKLVTKMFQKIQDLIDDKDALVFVLIDEVESLTAARNACRAGTEPSDAIRVVNAV    211 - 280
LTQIDQIKRHSNVVILTTSNITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQL    281 - 350
LTLRELEMIGFIENNVSKLSLLLNDISRKSEGLSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDK    351 - 420
QFEERKKLAAYI                                                              421 - 432
//

Text Mined References (31)

PMID Year Title