Property Summary

NCBI Gene PubMed Count 27
Grant Count 17
R01 Count 17
Funding $1,132,795.84
PubMed Score 25.75
PubTator Score 24.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer 1.300 0.001
hepatocellular carcinoma 1.300 0.000
osteosarcoma -1.168 0.006
atypical teratoid / rhabdoid tumor 1.100 0.000
tuberculosis and treatment for 6 months -1.100 0.000
Breast cancer 2.900 0.025
posterior fossa group B ependymoma 1.100 0.000
ovarian cancer -2.100 0.000

 GWAS Trait (1)

Gene RIF (11)

PMID Text
25717001 role for GMAP-210 in several trafficking steps at the ER-Golgi interface
25473115 GMAP-210 has a role for membrane tethering in maintaining Golgi structure and a role for Rab2 binding in linking tethering with downstream docking and fusion events at the Golgi apparatus.
24919196 Rb is present in HIF1alpha-ARNT/HIF1beta transcriptional complexes associated with TRIP230 as determined by co-immuno-precipitation, GST-pull-down and ChIP assays
20546612 Observational study of gene-disease association. (HuGE Navigator)
20089971 identification of a mutation affecting GMAP-210 in mice, and then in humans, as the cause of a lethal skeletal dysplasia
19730683 Observational study of gene-disease association. (HuGE Navigator)
19715559 Localisation of GMAP-210 (TRIP11) to Golgi is the result of the combined action of two domains (N- and C-terminal) that recognize different sub-regions of the Golgi apparatus.
19266077 Observational study of gene-disease association. (HuGE Navigator)
18451304 the attachment of golgin GMAP-210 to lipid membranes
15485806 demonstrate that the thyroid hormone receptor/retinoblastoma-interacting protein 230 (TRIP230) interacts directly with aryl hydrocarbon receptor nuclear translocator(ARNT) and is essential for both hypoxic and TCDD-mediated transcriptional responses
More...

AA Sequence

MSSWLGGLGSGLGQSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAIHAILRSENER      1 - 70
LKKLCTDLEEKHEASEIQIKQQSTSYRNQLQQKEVEISHLKARQIALQDQLLKLQSAAQSVPSGAGVPAT     71 - 140
TASSSFAYGISHHPSAFHDDDMDFGDIISSQQEINRLSNEVSRLESEVGHWRHIAQTSKAQGTDNSDQSE    141 - 210
ICKLQNIIKELKQNRSQEIDDHQHEMSVLQNAHQQKLTEISRRHREELSDYEERIEELENLLQQGGSGVI    211 - 280
ETDLSKIYEMQKTIQVLQIEKVESTKKMEQLEDKIKDINKKLSSAENDRDILRREQEQLNVEKRQIMEEC    281 - 350
ENLKLECSKLQPSAVKQSDTMTEKERILAQSASVEEVFRLQQALSDAENEIMRLSSLNQDNSLAEDNLKL    351 - 420
KMRIEVLEKEKSLLSQEKEELQMSLLKLNNEYEVIKSTATRDISLDSELHDLRLNLEAKEQELNQSISEK    421 - 490
ETLIAEIEELDRQNQEATKHMILIKDQLSKQQNEGDSIISKLKQDLNDEKKRVHQLEDDKMDITKELDVQ    491 - 560
KEKLIQSEVALNDLHLTKQKLEDKVENLVDQLNKSQESNVSIQKENLELKEHIRQNEEELSRIRNELMQS    561 - 630
LNQDSNSNFKDTLLKEREAEVRNLKQNLSELEQLNENLKKVAFDVKMENEKLVLACEDVRHQLEECLAGN    631 - 700
NQLSLEKNTIVETLKMEKGEIEAELCWAKKRLLEEANKYEKTIEELSNARNLNTSALQLEHEHLIKLNQK    701 - 770
KDMEIAELKKNIEQMDTDHKETKDVLSSSLEEQKQLTQLINKKEIFIEKLKERSSKLQEELDKYSQALRK    771 - 840
NEILRQTIEEKDRSLGSMKEENNHLQEELERLREEQSRTAPVADPKTLDSVTELASEVSQLNTIKEHLEE    841 - 910
EIKHHQKIIEDQNQSKMQLLQSLQEQKKEMDEFRYQHEQMNATHTQLFLEKDEEIKSLQKTIEQIKTQLH    911 - 980
EERQDIQTDNSDIFQETKVQSLNIENGSEKHDLSKAETERLVKGIKERELEIKLLNEKNISLTKQIDQLS    981 - 1050
KDEVGKLTQIIQQKDLEIQALHARISSTSHTQDVVYLQQQLQAYAMEREKVFAVLNEKTRENSHLKTEYH   1051 - 1120
KMMDIVAAKEAALIKLQDENKKLSTRFESSGQDMFRETIQNLSRIIREKDIEIDALSQKCQTLLAVLQTS   1121 - 1190
STGNEAGGVNSNQFEELLQERDKLKQQVKKMEEWKQQVMTTVQNMQHESAQLQEELHQLQAQVLVDSDNN   1191 - 1260
SKLQVDYTGLIQSYEQNETKLKNFGQELAQVQHSIGQLCNTKDLLLGKLDIISPQLSSASLLTPQSAECL   1261 - 1330
RASKSEVLSESSELLQQELEELRKSLQEKDATIRTLQENNHRLSDSIAATSELERKEHEQTDSEIKQLKE   1331 - 1400
KQDVLQKLLKEKDLLIKAKSDQLLSSNENFTNKVNENELLRQAVTNLKERILILEMDIGKLKGENEKIVE   1401 - 1470
TYRGKETEYQALQETNMKFSMMLREKEFECHSMKEKALAFEQLLKEKEQGKTGELNQLLNAVKSMQEKTV   1471 - 1540
VFQQERDQVMLALKQKQMENTALQNEVQRLRDKEFRSNQELERLRNHLLESEDSYTREALAAEDREAKLR   1541 - 1610
KKVTVLEEKLVSSSNAMENASHQASVQVESLQEQLNVVSKQRDETALQLSVSQEQVKQYALSLANLQMVL   1611 - 1680
EHFQQEEKAMYSAELEKQKQLIAEWKKNAENLEGKVISLQECLDEANAALDSASRLTEQLDVKEEQIEEL   1681 - 1750
KRQNELRQEMLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRLMGSILGVRREEMEQL   1751 - 1820
FHDDQGGVTRWMTGWLGGGSKSVPNTPLRPNQQSVVNSSFSELFVKFLETESHPSIPPPKLSVHDMKPLD   1821 - 1890
SPGRRKRDTNAPESFKDTAESRSGRRTDVNPFLAPRSAAVPLINPAGLGPGGPGHLLLKPISDVLPTFTP   1891 - 1960
LPALPDNSAGVVLKDLLKQ                                                      1961 - 1979
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25717001 2015 The golgin GMAP-210 is required for efficient membrane trafficking in the early secretory pathway.
25473115 2015 Coupling of vesicle tethering and Rab binding is required for in vivo functionality of the golgin GMAP-210.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24919196 2014 A TRIP230-retinoblastoma protein complex regulates hypoxia-inducible factor-1?-mediated transcription and cancer cell invasion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20089971 2010 Lethal skeletal dysplasia in mice and humans lacking the golgin GMAP-210.
More...