Property Summary

NCBI Gene PubMed Count 46
Grant Count 439
R01 Count 288
Funding $37,588,778.42
PubMed Score 45.09
PubTator Score 305.66

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15637 B7Z1Q1 C9JJE2 Q14818 Q14819 Q15913 Q8IY00 Q92744 Q92745 Q969H7 Q9BW01 Q9UEI0
Symbols BBP
MBBP
ZFM1
ZNF162
D11S636
ZCCHC25

Gene

SF1

PDB

1O0P   1OPI   2M0G   4FXW   1K1G   2M09   4FXX  

Gene RIF (15)

PMID Text
26420826 A novel function of SF1 in the initial recruitment of the U2 snRNP through direct interactions with two U2 snRNP-associated proteins.
25605964 We demonstrated that PRPF40B interacts directly with SF1 and associates with U2AF(65
25505242 The interaction of HIV-1 CA with human cellular splicing factor 1 (SF1) is identified by yeast two-hybrid screen
25145264 Gomafu indirectly modulates the function of the splicing factors SF1 and Celf3 by sequestering these proteins into separate nuclear bodies.
25043850 Data suggest that post-translational processing of SF1 (phosphorylation of Ser20) down-regulates nuclear import of SF1 via alterations in kinetic interaction of SF1 nuclear localization signal (NLS) with NLS receptor isoforms.
23273425 The conserved SPSP motif phosphorylation and the SF1/U2AF interface are essential in vivo.
22906951 Findings suggest that Zinc finger motif-1 (ZFM1) is an important factor for the stabilization of a contractile SMC phenotype under basal or mildly activating conditions.
21505248 central ;mystery' domain of SF1 crystals belonged to space group C2 and have most probable solvent contents of 64, 52 or 39% with three, four or five molecules per asymmetric unit, respectively
21146534 the conformational changes that are induced by assembly of the SF1/U2AF(65)/RNA complex serve to position the pre-mRNA splice site optimally for subsequent stages of splicing.
21062807 SF1 silencing affected alternative splicing of endogenous transcripts, establishing a previously unexpected role for SF1 and branch site-like sequences in splice site selection.
More...

AA Sequence

MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDL      1 - 70
GIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKV     71 - 140
MIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTAN    141 - 210
TMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCT    211 - 280
KCGGAGHIASDCKFQRPGDPQSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPA    281 - 350
NNPPPPSLMSTTQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGP    351 - 420
PPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPSGQPP    421 - 490
PPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQNTTTTTTSAGTGSIPPWQQQQAAAAASPGAPQM    491 - 560
QGNPTMVPLPPGVQPPLPPGAPPPPPPPPPGSAGMMYAPPPPPPPPMDPSNFVTMMGMGVAGMPPFGMPP    561 - 630
APPPPPPQN                                                                 631 - 639
//

Text Mined References (61)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
25605964 2015 Prp40 pre-mRNA processing factor 40 homolog B (PRPF40B) associates with SF1 and U2AF65 and modulates alternative pre-mRNA splicing in vivo.
25416956 2014 A proteome-scale map of the human interactome network.
25145264 2014 Formation of nuclear bodies by the lncRNA Gomafu-associating proteins Celf3 and SF1.
25043850 2014 Computational identification of post-translational modification-based nuclear import regulations by characterizing nuclear localization signal-import receptor interaction.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23273425 2013 Structure of phosphorylated SF1 bound to U2AF?? in an essential splicing factor complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22927646 2012 Acid ceramidase (ASAH1) represses steroidogenic factor 1-dependent gene transcription in H295R human adrenocortical cells by binding to the receptor.
More...