Property Summary

NCBI Gene PubMed Count 69
Grant Count 25
R01 Count 12
Funding $2,125,189.48
PubMed Score 1074.12
PubTator Score 206.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis 1.400 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.200 0.005

Gene RIF (47)

PMID Text
26582366 SUMOylation of TARBP2 is required for regulating siRNA efficiency.
25668122 HIV-1 Rev-response element RNA acts as an RNA silencing suppressor by competing with TRBP-bound siRNAs.
25668122 The binding of HIV-1 TAR and RRE to TRBP displaces small interfering (si) RNAs from binding to TRBP, but RNA interference is restored when HIV-1 Rev or GagPol are coexpressed in cells
25668122 The binding of HIV-1 TAR and RRE to TRBP displaces small interfering (si) RNAs from binding to TRBP, but RNA interference is restored when HIV-1 Rev or GagPol are coexpressed in cells
25557550 Results show the crystal structure of the interface between microRNA biogenesis proteins Dicer and TRBP. Mutations in this interface prevent recruitment of TRBP to Dicer.
25437560 the role of TRBP and unveils negative feedback regulation of PKR through TRBP phosphorylation.
25043050 identified TARBP2, a double-stranded RNA-binding protein implicated in microRNA processing, as the trans factor that binds the sRSE family and similar structural elements--collectively termed TARBP2-binding structural elements (TBSEs)--in transcripts
24563462 Tarbp2 binding to TRPC4 promotes changes of cytosolic Ca(2+) and, thereby, leads to a dynamic regulation of Dicer activity, essentially at low endogenous Dicer concentrations.
24563327 TARBP2 expression is upregulated in late-stage breast cancer and triple-negative breast cancer and may have a role in poorer disease-free survival and overall survival
24141778 RPL5 binds to the TRBP2 and Ago2 subunits of the RISC and mediates the binding to c-Myc 3'UTR.
More...

AA Sequence

MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGD      1 - 70
TSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPEDIPVFTAAAAATPVPSVVLT     71 - 140
RSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSK    141 - 210
KLAKRNAAAKMLLRVHTVPLDARDGNEVEPDDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLR    211 - 280
SCSLGSLGALGPACCRVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAARGE    281 - 350
AARRALQYLKIMAGSK                                                          351 - 366
//

Text Mined References (78)

PMID Year Title
26582366 2015 SUMOylation of TARBP2 regulates miRNA/siRNA efficiency.
25668122 2015 HIV-1 RRE RNA acts as an RNA silencing suppressor by competing with TRBP-bound siRNAs.
25608000 2015 Helical defects in microRNA influence protein binding by TAR RNA binding protein.
25557550 2015 Dicer-TRBP complex formation ensures accurate mammalian microRNA biogenesis.
25446899 2014 Cancer exosomes perform cell-independent microRNA biogenesis and promote tumorigenesis.
25437560 2014 Deletion of human tarbp2 reveals cellular microRNA targets and cell-cycle function of TRBP.
25416956 2014 A proteome-scale map of the human interactome network.
25043050 2014 Metastasis-suppressor transcript destabilization through TARBP2 binding of mRNA hairpins.
24563462 2014 Trans-activation response (TAR) RNA-binding protein 2 is a novel modulator of transient receptor potential canonical 4 (TRPC4) protein.
24563327 2014 Up-regulation and worse prognostic marker of cytoplasmic TARBP2 expression in obstinate breast cancer.
More...