Property Summary

NCBI Gene PubMed Count 81
PubMed Score 1238.42
PubTator Score 206.12

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 5.7e-06
malignant mesothelioma 1.200 9.5e-06
medulloblastoma, large-cell 1.200 4.9e-03
psoriasis 1.400 1.1e-04

Gene RIF (52)

AA Sequence

MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGD      1 - 70
TSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPEDIPVFTAAAAATPVPSVVLT     71 - 140
RSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSK    141 - 210
KLAKRNAAAKMLLRVHTVPLDARDGNEVEPDDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLR    211 - 280
SCSLGSLGALGPACCRVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAARGE    281 - 350
AARRALQYLKIMAGSK                                                          351 - 366
//

Text Mined References (89)

PMID Year Title