Property Summary

NCBI Gene PubMed Count 39
PubMed Score 256.17
PubTator Score 89.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.2e-02
intraductal papillary-mucinous neoplasm ... 1.200 1.3e-02
lung cancer 1.200 3.1e-02
medulloblastoma, large-cell 1.200 1.2e-04
Multiple myeloma 1.334 4.4e-03
osteosarcoma 1.448 1.8e-04
ovarian cancer -1.400 4.2e-04
psoriasis -1.100 1.2e-03
tuberculosis and treatment for 6 months 1.100 3.3e-05
Waldenstrons macroglobulinemia 1.380 9.2e-03

Protein-protein Interaction (1)

Gene RIF (19)

AA Sequence

MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGFQDIPKRCLKAREHFGTVKT      1 - 70
HLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDY     71 - 140
LSGVLILASELSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKYDVKKVEEVVY    141 - 210
DLSIRGFNKETAAACVEK                                                        211 - 228
//

Text Mined References (45)

PMID Year Title