Property Summary

NCBI Gene PubMed Count 37
Grant Count 57
R01 Count 33
Funding $10,336,223.31
PubMed Score 235.02
PubTator Score 89.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.380 0.009
Multiple myeloma 1.334 0.004
psoriasis -1.100 0.001
osteosarcoma -1.976 0.000
group 4 medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.200 0.000
tuberculosis and treatment for 6 months 1.300 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.013
lung cancer 1.200 0.031
ovarian cancer -1.400 0.000

Gene RIF (17)

PMID Text
25457613 These findings indicate that miRNA depletion in dicer deficiency is due to the combined loss of miRNA-generating activity and catabolic function of TN/TX.
25433126 this study argues against a mechanism by which translin octamers may "dissociate and reassemble" upon RNA binding and report a novel "open"-barrel structure of human translin revealing a feasible DNA/RNA entryway into the cavity.
24338081 The selectivity of PLCbeta toward certain genes lies in the rate at which the RNA is hydrolyzed by C3PO.
23980029 The data demonstrates that the configuration of translin and translin-RNA complexes in solution is a dimer of tetramers, which undergoes conformational transitions.
22427937 Translin B3 motif, corresponding to TRAX B3 residues, contributes towards its DNA binding activity.
21552258 C3PO endonuclease is an asymmetric octamer barrel consisting of six translin and two TRAX subunits which activates RISC by degrading the Ago2-nicked passenger strand of siRNA.
19805324 Findings implicate abnormal dendritic trafficking of BDNF mRNA in the pathophysiology of neuropsychiatric disorders linked to the translin G196A mutation.
16411762 Human translin exhibits a stable octameric state and binds ssDNA/RNA/dsDNA targets, all of which get attenuated when GTP is added
16218753 Results describe a circular dichroism analysis of complexes formed between human translin and the microsatellite and telomeric oligodeoxynucleotides d(GT)(12) and d(TTAGGG)(5).
15919079 Translin "chaperones" Trax and forms heteromeric complex that is DNA binding competent
More...

AA Sequence

MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGFQDIPKRCLKAREHFGTVKT      1 - 70
HLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDY     71 - 140
LSGVLILASELSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKYDVKKVEEVVY    141 - 210
DLSIRGFNKETAAACVEK                                                        211 - 228
//

Text Mined References (43)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25457613 2014 Rescuing dicer defects via inhibition of an anti-dicing nuclease.
25433126 2015 A novel open-barrel structure of octameric translin reveals a potential RNA entryway.
24962563 2014 Genome-wide genetic and transcriptomic investigation of variation in antibody response to dietary antigens.
24338081 2014 Hydrolysis rates of different small interfering RNAs (siRNAs) by the RNA silencing promoter complex, C3PO, determines their regulation by phospholipase C?.
23980029 2013 Conformational transitions in human translin enable nucleic acid binding.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22427937 2012 Identification of nucleic acid binding sites on translin-associated factor X (TRAX) protein.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...