Property Summary

NCBI Gene PubMed Count 15
Grant Count 4
R01 Count 3
Funding $129,853.01
PubMed Score 3.72
PubTator Score 615.84

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15629 B4E0K2
Symbols TRAM
PNAS8
TRAMP

Gene

 GO Function (1)

Gene RIF (6)

PMID Text
25600807 TRAM1 protect HepG2 cells from palmitate-induced insulin resistance. The protection of TRAM1 to HepG2 cells is through endoplasmic reticulum stress-JNK pathway.
20588308 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAIRKKSTKSPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITAKASIIFVTLQYNVTLPATEEQATESV      1 - 70
SLYYYGIKDLATVFFYMLVAIIIHAVIQEYMLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFIL     71 - 140
ISENYISDPTILWRAYPHNLMTFQMKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGA    141 - 210
YLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSNEKYQKGFSLWAVLFVLGRLLTLILSVLTVGFGLARAE    211 - 280
NQKLDFSTGNFNVLAVRIAVLASICVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGT    281 - 350
ENGVNGTLTSNVADSPRNKKEKSS                                                  351 - 374
//

Text Mined References (23)

PMID Year Title
25600807 2015 TRAM1 protect HepG2 cells from palmitate induced insulin resistance through ER stress-JNK pathway.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...