Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.82
PubTator Score 615.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.043 3.2e-05
Astrocytoma, Pilocytic 1.100 1.9e-06
atypical teratoid / rhabdoid tumor 1.100 4.6e-05
autosomal dominant Emery-Dreifuss muscul... 1.125 2.9e-03
dermatomyositis 1.200 4.7e-03
Down syndrome 1.700 5.1e-04
Duchenne muscular dystrophy 1.340 3.5e-09
ependymoma 1.300 8.3e-15
glioblastoma 1.100 1.3e-06
group 3 medulloblastoma 1.200 4.4e-02
invasive ductal carcinoma 1.200 1.4e-02
juvenile dermatomyositis 1.321 1.3e-12
lung adenocarcinoma 1.905 8.5e-07
lung cancer -1.100 6.7e-04
medulloblastoma, large-cell 1.500 1.2e-04
Multiple myeloma 1.027 7.0e-03
osteosarcoma 1.959 1.8e-05
ovarian cancer -1.200 9.6e-04
pancreatic ductal adenocarcinoma liver m... -2.122 3.3e-02
pediatric high grade glioma 1.200 2.3e-06
subependymal giant cell astrocytoma 1.124 3.2e-02

Gene RIF (6)

AA Sequence

MAIRKKSTKSPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITAKASIIFVTLQYNVTLPATEEQATESV      1 - 70
SLYYYGIKDLATVFFYMLVAIIIHAVIQEYMLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFIL     71 - 140
ISENYISDPTILWRAYPHNLMTFQMKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGA    141 - 210
YLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSNEKYQKGFSLWAVLFVLGRLLTLILSVLTVGFGLARAE    211 - 280
NQKLDFSTGNFNVLAVRIAVLASICVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGT    281 - 350
ENGVNGTLTSNVADSPRNKKEKSS                                                  351 - 374
//

Text Mined References (23)

PMID Year Title