Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.13
PubTator Score 0.11

Knowledge Summary

Patent (533)

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.300 0.000
group 3 medulloblastoma -1.100 0.011
ovarian cancer 1.700 0.000
pituitary cancer -2.200 0.000

AA Sequence

MEPGNDTQISEFLLLGFSQEPGLQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMYFFLSNLSFAD      1 - 70
ICVTSTTIPKMLMNIQTQNKVITYIACLMQMYFFILFAGFENFLLSVMAYDRFVAICHPLHYMVIMNPHL     71 - 140
CGLLVLASWTMSALYSLLQILMVVRLSFCTALEIPHFFCELNQVIQLACSDSFLNHMVIYFTVALLGGGP    141 - 210
LTGILYSYSKIISSIHAISSAQGKYKAFSTCASHLSVVSLFYGAILGVYLSSAATRNSHSSATASVMYTV    211 - 280
VTPMLNPFIYSLRNKDIKRALGIHLLWGTMKGQFFKKCP                                   281 - 319
//

Text Mined References (9)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14983052 2004 The human olfactory receptor gene family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9268701 1997 Molecular cloning and chromosomal mapping of olfactory receptor genes expressed in the male germ line: evidence for their wide distribution in the human genome.
9119360 1997 Specific repertoire of olfactory receptor genes in the male germ cells of several mammalian species.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.