Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent (162)

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 4.0e-10

AA Sequence

MEKRNLTVVREFVLLGLPSSAEQQHLLSVLFLCMYLATTLGNMLIIATIGFDSHLHSPMYFFLSNLAFVD      1 - 70
ICFTSTTVPQMVVNILTGTKTISFAGCLTQLFFFVSFVNMDSLLLCVMAYDRYVAICHPLHYTARMNLCL     71 - 140
CVQLVAGLWLVTYLHALLHTVLIAQLSFCASNIIHHFFCDLNPLLQLSCSDVSFNVMIIFAVGGLLALTP    141 - 210
LVCILVSYGLIFSTVLKITSTQGKQRAVSTCSCHLSVVVLFYGTAIAVYFSPSSPHMPESDTLSTIMYSM    211 - 280
VAPMLNPFIYTLRNRDMKRGLQKMLLKCTVFQQQ                                        281 - 314
//

Text Mined References (7)

PMID Year Title