Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MSGENNSSVTEFILAGLSEQPELQLPLFLLFLGIYVVTVVGNLGMTTLIWLSSHLHTPMYYFLSSLSFID      1 - 70
FCHSTVITPKMLVNFVTEKNIISYPECMTQLYFFLVFAIAECHMLAAMAYDRYMAICSPLLYSVIISNKA     71 - 140
CFSLILGVYIIGLVCASVHTGCMFRVQFCKFDLINHYFCDLLPLLKLSCSSIYVNKLLILCVGAFNILVP    141 - 210
SLTILCSYIFIIASILHIRSTEGRSKAFSTCSSHMLAVVIFFGSAAFMYLQPSSISSMDQGKVSSVFYTI    211 - 280
IVPMLNPLIYSLRNKDVHVSLKKMLQRRTLL                                           281 - 311
//

Text Mined References (5)

PMID Year Title
18674749 2008 Extensive copy-number variation of the human olfactory receptor gene family.
17973576 2007 Genetic elucidation of human hyperosmia to isovaleric acid.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9119360 1997 Specific repertoire of olfactory receptor genes in the male germ cells of several mammalian species.