Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.00

Knowledge Summary

Patent (386)

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.0e-08
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Gene RIF (1)

AA Sequence

MEPQNTTQVSMFVLLGFSQTQELQKFLFLLFLLVYVTTIVGNLLIMVTVTFDCRLHTPMYFLLRNLALID      1 - 70
LCYSTVTSPKMLVDFLHETKTISYQGCMAQIFFFHLLGGGTVFFLSVMAYDRYIAISQPLRYVTIMNTQL     71 - 140
CVGLVVAAWVGGFVHSIVQLALILPLPFCGPNILDNFYCDVPQVLRLACTDTSLLEFLMISNSGLLVIIW    141 - 210
FLLLLISYTVILVMLRSHSGKARRKAASTCTTHIIVVSMIFIPCIYIYTWPFTPFLMDKAVSISYTVMTP    211 - 280
MLNPMIYTLRNQDMKAAMRRLGKCLVICRE                                            281 - 310
//

Text Mined References (7)

PMID Year Title